Selaginella moellendorffii: SELMODRAFT_84637 Help Entry SELMODRAFT_84637  CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K25829   transcription elongation factor 1 Organism smo  Selaginella moellendorffii Brite KEGG Orthology (KO) [BR:smo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:smo03400]     SELMODRAFT_84637 DNA repair and recombination proteins [BR:smo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      Other TCR factor       SELMODRAFT_84637 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_Elf1 Lar_restr_allev Zn_ribbon_SprT Motif Other DBs NCBI-GeneID:  9652170 NCBI-ProteinID:  XP_002965704 JGI:  84637 UniProt:  D8R4M1 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MGKRKSAKKPQPSRKMQEKLPSVFSCPFCNHESSVECRMDRKNAVGEASCRICQEKYSTQ IDALSEPIDVYSEWIDECERANTAS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgggcaagcgcaaatccgccaagaagccgcagcccagcagaaagatgcaggagaagctg ccatcggtgtttagctgcccgttctgcaatcacgagagcagcgtcgagtgccgcatggat cgaaagaatgccgtgggcgaagcgtcgtgcaggatttgccaggagaagtactccactcaa attgacgctttgagcgagccaatcgatgtctatagcgaatggatcgacgaatgcgagcga gcaaacactgcctcgtga

DBGET integrated database retrieval system