KEGG   Streptomyces mobaraensis: J7W19_03235
Entry
J7W19_03235       CDS       T07674                                 
Name
(GenBank) alpha/beta fold hydrolase
  KO
K24569  avermectin polyketide synthase AveA4
Organism
smob  Streptomyces mobaraensis
Pathway
smob00522  Biosynthesis of 12-, 14- and 16-membered macrolides
smob01052  Type I polyketide structures
smob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smob00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    J7W19_03235
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    J7W19_03235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:smob01008]
    J7W19_03235
Polyketide biosynthesis proteins [BR:smob01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   cis-AT PKS
    Avermectin PKS
     J7W19_03235
SSDB
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KAsynt_C_assoc Thioesterase PP-binding Thiolase_N PKS_DE Docking SAT Abhydrolase_6 Abhydrolase_1 Abhydrolase_3 Abhydrolase_5
Other DBs
NCBI-ProteinID: QTT72582
UniProt: M3AVJ7
LinkDB
Position
complement(850125..857771)
AA seq 2548 aa
MGTEEKTAASGGGAPQRTEDKLRYYLKRVTADLGETRRRLEEMEAVAGEPIAVVGMACRF
PGGVGSPEELWRLVDEGRDAVEPFPADRGWDLDALYHPDPDHPGTCYAREGGFLRGADRF
DAGFFGIGPREALAMDPQQRLLLETSWEALERAGIDPETLRGSRAGVFVGTGHQEYGALL
QRATENFEGYLLSGSAASVLSGRLSYVLGLEGPAVTVDTACSSSLVTLHLACQSLRRGES
TVALAGGAAVMASPGMFVEFSRQRGMAPDGRCKAFAASADGTGWGEGVGMLVLERLSDAR
RNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIWQALADARLSARDVDAVEAHGTGT
RLGDPIEAQALLATYGQDRPAEQPLLLGSLKSNIGHTQAAAGVAGVIKTVLALRHGVLPR
TLHVDEPTPHVDWSAGAVELLTERREWPDTGRPRRAGVSSFGVSGTNAHVILEQAPEEEP
ATPAEVVEVLPWPLSAKSAGALRAQAERLATHLDSRPDADPAAVGWTLATGRTAFAQRAV
VVGGPGELGAGVRELAASGAAPGLVTGEAAATHDGAVFVFPGQGSQWAGMAVGLLDTSTV
FRESAEACERALKPYVDWSLTDVLRGTPGAPGLERVDVVQPVLWAVMVSLAALWRSMGVE
PVGVVGHSQGEIAAACVAGGLSLEDGARVAALRSRAIGEILSGSGGMVAVTLGADAVAGL
LDGLGDRASVAAVNGPQSTVVSGEPAALEELLARCEAREIRARRVPVDYASHSAQVERVR
ERVLADLAGIRPRTGTVPFHSTLTGGTVDTAGLDADYWYRNLRETVRFAPVVRDLLAQGE
GAFVECSPHPVLTVGIEEAAQDADMPAVAVGSLRRDEGDWRRFLTSVAEAHTRGLAVDWA
PAFPPATRRLADLPTYAFQRRGYWVETRPGDRDPLEERFWTAVADEDHDGLAALLELADP
DELARLDALLPTLSAWWSRRAERAPRVREEEEPDTAASALRRRLEGLPEAERVRVLVDLV
AAHAVAVLGQEVRVEPGRPFNEIGFVSLTAVELRNRLRAATGLPLPATVVFDHPTPEALS
RRILAELLGEDARDVPPAALTTAPDDDPIAVVGMACRFPGGVAGPEDLWRLVADGRDAIT
PFPENRGWDLEAVYDPDPAHPGTTYTREGGFIEDADRFDAALFGISPREALAMDPQQRLL
LETAWEAFERAGIDPTSLRGSRTGVFTGSSGQDYTALAAGAAEGLEGYVLTGNAASVISG
RLAYAFGLEGPAVTVDTACSSSLVALHLACQSLRSGESTLALAGGVTVLSTPQAFVGFSR
QRGLAPDGRCKAFSAAADGTAWGEGAGLLLVERLSDARRNGHPVLALVRGTATNQDGASN
GLAAPNGPSQQRVITQALANAGLSPADVDAVDAHGTGTPLGDPIEAQALIAAYGKDRPAG
RPLWLGSVKSNIGHTAAAAGLAGVIKMIKAMEHGVLPRTLHADEPTPHVDWSSGAVSLLT
EQRDWPEPGRPRRAAVSSFGISGTNAHVILEQGAGEALPEPARDAVAPAVGETASGEDGL
VLADGGSVPAEDVSAPVGDVPAPAVGEARPAERGPASAAGARVSVEDGSPSAQGGSVRDV
SAPVVSESAPADGGASAHAASAPARSEAADAGAPGSTPALVPCVLSARGEQALRAQAERL
RAHVAERPGLTPLDVGYSLATTRGALEHRAAVLAADRDGLLAGLAALAGGTPAPHVVRDV
AAGGRTAFLFPGQGSQRPGAGRALYAAFPAYAEALDEVCGHLDAHLEHPLRDVLFAEEGT
PAAALLDDTAYTQPALFATGVALARLLEGWDVVPDRLGGHSIGELTAAHVAGVLSLEDAC
ALVAARGRLMAASSPDGIMVAVEAAEDEVAAALADDDRVGIAAVNGPRATVMSGPCEAVE
RVADLLAARGRRTKRLRVTRGFHSPLMDEVLDAFRSVAAGLDYRAPRVTLVSNVTGEILE
AEEVCTPDYWVRHIRRPVRFHDGVRRLAADGVTTFLELGPGGVLSALVRDALADADGDGR
GAAAVPLLRRGQDEETSLITALARARTRGAAGPGWARFHAERGARRVALPTYAFQRRRYW
PDVVAPAMPGTPVTGGPAPAAAEPVTEGPSLRDRLLPLSGGERERLVTELAATHIAAVLG
HPTTEAVEASVGLPELGFDSLAAAELRTALQAATGLTLSTSLVFDHPTLKALAAHLLAAL
EATAEEEADGGTLAALALRAGELGEFAAFQELLRTASRYRPVFGAGERPAVSPEPVRLSR
GPAGTRLLCFPSFAGRSGAHQYARLAAAAHDTAELWALPAPGFTPGEALPDSLEALARHH
AEDVRRCAPDGPFALLGHSAGGWIAHAVAARLEALGTPADAVVLLDSYVPGSPALSAIQE
EIGRRLRAGGGSLGPGDDRWDDTCLTAMGGYDRLFTGWRPEPLAATPVVHLRAAEPLAAF
ADVPDLSDPSDLPGSPGVGWRAAWPAADTTGEVPGDHFGLAGEHAPGTLRTVLDRLAGRD
GEGQDGTGDGTGPDGTGPGAATEPPHRR
NT seq 7647 nt   +upstreamnt  +downstreamnt
atggggaccgaggagaagaccgccgcgagcggcggaggcgcgccgcagcgcaccgaggac
aaactgcgctactacctcaagcgcgtcaccgccgacctgggcgagacccggcgccggctg
gaggagatggaggccgtcgcgggcgagccgatcgccgtcgtcggcatggcctgccgcttc
ccgggcggcgtcggcagccccgaggagctgtggcggctggtcgacgagggacgggacgcc
gtcgagccgttccccgccgaccgcggctgggacctcgacgcgctctaccacccggacccc
gaccacccgggcacctgctacgcccgcgagggcggcttcctgcgcggcgccgaccgcttc
gacgccgggttcttcggcatcggcccgcgcgaggcgctggccatggacccgcagcagcgg
ctgctgctggagacctcgtgggaggcgctggaacgggccgggatcgacccggagacgctg
cgcggcagccgcgccggagtcttcgtcggcaccggccaccaggagtacggcgccctcctc
cagcgcgccaccgagaacttcgagggctacctgctctccggcagcgcggccagcgtcctc
tccggccggctgtcgtacgtcctcggcctggagggccccgccgtcaccgtcgacaccgcc
tgctcctcgtcgctggtgaccctgcacctggcctgccagtcgctgcggcgcggcgagtcc
acggtggcgctggccggcggcgcggcggtcatggcgtcgccgggcatgttcgtcgagttc
agccggcaacgggggatggcccccgacggccggtgcaaggcgttcgccgcctcggccgac
ggcaccggctggggcgagggcgtcggcatgctcgtcctcgaacggctctccgacgcgcgc
cgcaacgggcatccggtgctcgccgtcgtccgcgggtccgccgtcaaccaggacggcgcc
tccaacgggctcaccgcgcccaacggcccgtcccagcagcgggtcatctggcaggcgctc
gccgacgcccggctctccgcccgcgacgtggacgccgtcgaggcgcacgggacgggcacc
cggctcggcgaccccatcgaggcgcaggcgctcctggccacgtacgggcaggaccgtcct
gccgaacagccgctgctgctcggctcgttgaagtccaacatcggccacacgcaggccgcg
gcgggcgtcgccggcgtcatcaagaccgtgctggcgctgcgacacggcgtcctcccgcgc
accctgcacgtcgacgagccgaccccgcacgtcgactggtcggccggcgccgtcgagctg
ctcaccgagcggcgggagtggccggacaccggccgcccccggcgggccggcgtatcctcc
ttcggcgtcagcggcaccaacgcccacgtcatcctcgaacaggcgccggaggaggagccg
gccacgcccgccgaggtcgtggaggtgctgccctggccgctgtccgccaagagcgcgggc
gccctgcgcgcccaggccgaacgcctcgccacgcacctcgactcccggccggacgccgac
ccggcggccgtcggctggacgctcgccaccgggcggaccgccttcgcccagcgggccgtc
gtcgtcggcggacccggcgaactcggcgcaggcgtacgggaactggcggcctccggtgcc
gcgcccggcctggtcaccggcgaggccgccgccacccacgacggcgcggtcttcgtcttc
cccggccagggctcccagtgggccggcatggccgtcggcctcctcgacaccagcacggtc
ttccgggagagcgccgaggcgtgcgagcgggccctgaaaccgtacgtggactggtcgttg
accgacgtcctgcgcggcacgcccggcgcccccgggctggagcgcgtcgacgtcgtccag
ccggtgctgtgggccgtgatggtgtcgctcgcggcgctgtggcggtcgatgggcgtggag
cccgtcggcgtcgtcgggcactcgcagggcgagatcgccgccgcctgcgtcgcgggcggc
ctgtcgctggaggacggcgcccgggtggccgcgctgcgctcccgggccatcggcgagatc
ctgtccggcagcggcggcatggtggccgtcaccctcggcgcggacgccgtcgccggactg
ctggacggcctcggcgaccgggcgtccgtcgccgccgtcaacgggccgcagtccaccgtc
gtgtccggtgaacccgccgccctggaggagctgctggcccgctgcgaggcgcgggagatc
cgcgcccggcgcgttcccgtcgactacgcctcccactccgcccaggtggagcgcgtccgc
gagcgcgtcctcgccgacctggccggcatccggccgcgcaccgggaccgtccccttccac
tccacgctcaccggcgggacggtcgacaccgccgggctggacgccgactactggtaccgc
aacctccgcgagaccgtccgcttcgcgcccgtcgtccgcgacctgctcgcccagggcgag
ggcgcgttcgtcgagtgcagcccgcaccccgtcctcaccgtcggcatcgaggaggccgcg
caggacgcggacatgcccgccgtcgccgtcggctcgctccgccgcgacgagggcgactgg
cgccgcttcctcacctccgtggccgaggcgcacacccgcggcctcgccgtggactgggcc
ccggccttcccgcccgccacccgccgcctcgccgacctgcccacctacgccttccagcgg
cgcggctactgggtcgagacccgacccggcgaccgggacccgctggaggagcggttctgg
acggccgtcgccgacgaggaccacgacgggctcgcggccctcctcgaactggccgacccc
gacgaactcgcccggctggacgccctgttgccgaccctgtcggcctggtggtcccggcgc
gccgaacgcgctccccgggtacgggaagaggaggagcccgacacggccgcgtccgcgctg
cgccggcggctggagggactgcccgaggccgaacgggtccgggtgctggtcgacttggtg
gccgcgcacgccgtcgccgtgctcgggcaggaggtacgggtcgagcccggaaggccgttc
aacgagatcggcttcgtgtcgctcaccgccgtggagctccgcaaccggctgcgcgcggcg
acgggcctgccgctcccggcgacggtggtcttcgaccacccgaccccggaggcgctgagc
cgccggatcctcgccgaactcctcggcgaggacgcgcgggacgtcccgcccgccgccctg
accacggcgcccgacgacgatccgatcgccgtcgtcggcatggcctgccgcttcccgggc
ggcgtcgccggccccgaggacctctggcgtctggtggccgacgggcgcgacgcgatcacc
ccgttccccgagaaccggggctgggacctggaagccgtctacgatcccgaccccgcccac
cccggcaccacctacacccgcgagggcggcttcatcgaggacgccgaccggttcgacgcc
gcgctgttcggcatcagcccccgcgaggcgctggccatggacccgcagcagcggctgctg
ctggagaccgcctgggaggcgttcgaacgcgccggcatcgacccgacgtcactgcgcggc
agccgcaccggcgtgttcaccggctccagcggccaggactacaccgcgctggccgccggc
gcggcggagggcctggaggggtacgtcctcacgggcaacgccgccagtgtcatctccggc
cgcctcgcctacgcgttcggcctggaaggcccggccgtcacggtggacaccgcctgctcc
tcctccctggtggccctgcacctggcctgccagtcgctgcgttcgggcgagtcgacgctc
gccctcgcgggcggggtgaccgtgctgtccacgccgcaggcgttcgtcgggttctcccgg
cagcgcgggctggcgccggacgggcgctgcaaggcgttctcggccgccgccgacggcacg
gcctggggcgagggcgccggactgctcctcgtcgagcggctgtccgacgcgcgccgcaac
ggccaccccgtcctcgccctggtccggggcaccgccaccaaccaggacggcgccagcaac
ggcctcgccgcccccaacggcccgtcccagcagcgcgtcatcacccaggccctggccaac
gccggactgtccccggcggacgtggacgccgtcgacgcccacggcaccggcaccccgctc
ggcgaccccatcgaggcccaggcgctgatcgccgcctacggcaaggaccgccccgccggc
cgtccgctgtggctgggctcggtgaagtccaacatcggccacacggccgccgcggcgggc
ctggccggcgtcatcaagatgatcaaggccatggaacacggcgtcctgccccggaccctg
cacgccgacgaacccaccccgcacgtcgactggtcgtccggcgcggtgtccctgctgacg
gagcaacgggactggccggagcccggccgcccgcgccgggcggcggtctcgtcgttcggc
atcagcggcaccaacgcgcacgtcatcctggaacagggggcgggggaggcccttcccgag
cccgcgcgggacgcggtcgcgccggcggtgggggagacggcgtccggggaggacggcctt
gtgctcgcggacggcggttcggtgccggccgaggacgtgtcggcccccgtgggggacgta
ccggcaccggcggtgggtgaggcgcggcccgcagagcgcgggccggcgtccgcggcgggc
gcgcgggtatccgtggaggacggttcgccgtcggcccagggcgggtccgtccgggacgtg
tccgcgccggtggtgtccgagtcggcaccggccgacggcggcgcgtccgcacacgcggcc
tccgctcccgcgcggagtgaagcggcggacgccggagcccccgggagcacgcccgcgctc
gtcccctgtgtcctctccgcccggggcgagcaggccctgcgcgcccaggccgagcggctg
cgcgcccacgtcgccgagcggcccggtctgacgccgctggacgtcggctactccctcgcc
accacgcgcggagcgctggagcaccgggccgccgtcctcgcggccgaccgcgacggcctg
ctcgccgggctggccgcgctggccggcggcacaccggcgccgcacgtcgtccgcgacgtc
gccgccggcggccggacggccttcctcttccccgggcagggcagccagcgcccgggcgcc
ggccgcgcgctgtacgcggcgttcccggcctacgcggaggcgctggacgaggtctgcggc
cacctggacgcgcacctcgaacacccgctcagggacgtgctgttcgccgaggaggggacg
cccgccgccgcgctgctcgacgacaccgcgtacacccagcccgccctgttcgcgacgggc
gtcgcgctcgcccgcctgctggagggctgggacgtcgtcccggaccggctcggcgggcac
tcgatcggcgagctgaccgccgcccacgtggcgggcgtgctctccctggaggacgcctgt
gccctggtcgccgcccgcggccggctgatggcggcctcctcacccgacgggatcatggtc
gccgtcgaggccgccgaggacgaggtggccgccgccctggccgatgacgaccgggtgggg
atcgcggccgtcaacggcccccgcgcgacggtgatgtccggcccgtgcgaggccgtcgaa
cgggtggccgatctcctcgccgcccggggccgccgcaccaagcggctgcgcgtgacgcgc
ggtttccactcgccgctgatggacgaggtgctggacgccttccggtccgtcgcggccggg
ctcgactaccgcgcccctcgcgtcaccctggtgtccaacgtgaccggagagatcctggag
gcggaggaggtgtgcaccccggactactgggtgcggcacatccgccgcccggtgcgcttc
cacgacggcgtccggcggctggccgccgacggcgtgacgacgttcctcgaactcggcccg
ggcggtgtcctctcggcgctggtccgggacgcgctggcggacgcggacggggacgggcgc
ggcgccgccgccgtaccgctgctccggcgcgggcaggacgaggagacgagcctgatcacc
gccctcgcccgggcccggacacgcggcgcggcgggccccggctgggcacgcttccacgcc
gaacgcggcgcccggcgcgtcgcgttgcccacctacgccttccaacggcggcgctactgg
cccgacgtcgtcgcccccgccatgccgggaacccccgtcaccggcggcccggctccggcg
gccgccgaacccgtcaccgaaggaccgtcgctgcgcgaccgcctcctgccgctctccggc
ggcgaacgggagcgcctcgtgaccgagttggcggcgacgcacatcgccgccgtgctcggc
caccccacgacggaggccgtggaggcgagcgtcggcctgcccgagctgggcttcgactcg
ctcgccgccgccgagctccgcaccgccctccaggcggccaccggcctcaccctgtccacc
tcgctggtcttcgaccaccccaccctcaaggcgctcgccgcccacctgctggccgccctg
gaggccaccgccgaggaggaggcggacggcggcaccctcgccgcgctcgccctgcgggcc
ggggaactcggcgagttcgccgccttccaggaactgctgcggaccgcctcccgctaccgt
ccggtcttcggcgcgggcgagcgcccggcggtgagcccggagcccgtccggctctcccgg
ggcccggcaggcacccgcctgctctgcttcccgtcgttcgccggccgctccggggcccac
cagtacgcccggctcgccgcggcggcccacgacacggccgagctgtgggccctgcccgcc
cccggcttcaccccgggcgaggccctccccgacagcctggaggcgctcgcccgccaccac
gccgaggacgtccggcgctgcgcccccgacggcccgttcgccctcctcgggcactccgcg
ggcggctggatcgcccacgccgtcgccgcccggctggaagcgctcggcaccccggccgac
gccgtcgtcctgctcgacagctacgtccccggcagcccggcgctgtccgcgatccaggag
gagatcggccggcggctgcgcgccggcggcggctccctcggccccggcgacgaccgctgg
gacgacacctgcctgaccgccatgggcggctacgaccggctgttcaccggctggcggccg
gagccgctggccgccaccccggtcgtccacctgcgggcggccgaaccgctggccgcgttc
gcggacgtcccggacctctcggacccgtcggacctcccgggctccccgggcgtcggctgg
cgggccgcctggcccgcggcggacaccaccggcgaggtgcccggcgaccacttcggcctg
gccggagagcacgccccgggcaccctgcgcaccgtcctggaccggctcgcgggccgggac
ggcgaggggcaggacggtaccggagacggcacgggaccggacggcaccggcccgggcgcc
gccaccgagccaccccaccgccgctga

DBGET integrated database retrieval system