KEGG   Streptomyces mobaraensis: J7W19_30855
Entry
J7W19_30855       CDS       T07674                                 
Name
(GenBank) aromatase/cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
smob  Streptomyces mobaraensis
Pathway
smob01056  Biosynthesis of type II polyketide backbone
smob01100  Metabolic pathways
smob01110  Biosynthesis of secondary metabolites
Module
smob_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:smob00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    J7W19_30855
Enzymes [BR:smob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     J7W19_30855
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: QTT77202
LinkDB
Position
7141319..7142266
AA seq 315 aa
MTEPETREAEHGITVAAPAADVYALLADVENWPLLFPPTVHAERTERVGASERIRIWATA
NGTAKTWTSLRLLDPVRRRIEFRQEVPAPPVAAMGGTWLADPLSPATTRVTLRHHYRAAD
GDPDGLAWIEAAVDRNSRAELAALKDHAESAAGTPDGRVLDFEDTVRIDGEAKDVYEFLD
RADRWAERLPHVAAATVAEDTPGLQRLRMDTRAPDGTTHTTESVRVCFPHHLIVYKQTTL
PALMSLHTGRWRLERDADGTLATSRHTVVLATENITRVLGEDAGVPEAAAYVREALSANS
RATLGRAKEYAEGRR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgacggagccggagacccgcgaggcggagcacggcatcaccgtggcggcacccgccgcc
gacgtctacgcgctgctggcggacgtggagaactggccgctgctgttcccgcccaccgtg
cacgccgaacggaccgaacgcgtcggcgcgtcggagcggatccgcatctgggccaccgcc
aacggcacggccaagacctggacctcgctgcgcctgctcgatcccgtacggcggcggatc
gagttccgccaggaagtgccggcgccgcccgtggcggccatgggcggcacctggctggcc
gacccgctgtcacccgccaccacccgcgtcaccctgcgccaccactaccgggccgcggac
ggcgacccggacggcctcgcctggatcgaggcggccgtcgaccgcaacagccgcgccgaa
ctggcggccctcaaggaccacgccgagtccgccgccggaacgccggacggacgcgtcctg
gacttcgaggacaccgtccggatcgacggcgaggccaaggacgtctacgagttcctcgac
cgcgccgaccggtgggccgaacgcctcccgcacgtcgccgccgccaccgtggccgaggac
acccccggactccagcggctccgcatggacacccgcgccccggacggcaccacgcacacc
accgagtcggtgcgggtctgcttcccgcaccacctcatcgtctacaagcagaccacgctg
cccgccctgatgagcctgcacaccggccggtggcggctggagcgggacgcggacggcacc
ctcgccacctcgcggcacaccgtcgtcctcgcgacggagaacatcacgcgcgtcctgggg
gaggacgccggtgtccccgaggccgccgcgtacgtccgggaggccctgagcgccaacagc
agggccaccctgggccgcgccaaggagtacgcggaaggccggcggtga

DBGET integrated database retrieval system