Sordaria macrospora: SMAC_01092 Help Entry SMAC_01092        CDS       T01610                                  Name (RefSeq) uncharacterized protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism smp  Sordaria macrospora Pathway smp03020   RNA polymerase smp03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:smp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SMAC_01092   09124 Replication and repair    03420 Nucleotide excision repair     SMAC_01092  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:smp03021]     SMAC_01092    03400 DNA repair and recombination proteins [BR:smp03400]     SMAC_01092 Transcription machinery [BR:smp03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SMAC_01092   RNA polymerase III system    RNA polymerase III      SMAC_01092   RNA polymerase I system    RNA polymerase I      SMAC_01092 DNA repair and recombination proteins [BR:smp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SMAC_01092 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD zinc-ribbon_6 Motif Other DBs NCBI-GeneID:  10807707 NCBI-ProteinID:  XP_003350200 UniProt:  F7VM88 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MSSREQYQVPNSQGFTTGASNNDGNSGGSSVMWYTCGDCAVRVPLEKGAPIRCQKCGARV LYKERTKRMVQFEAR NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcttcccgcgagcaataccaagtccccaactcccagggcttcaccaccggcgcctcc aacaacgacggcaacagcggcggcagcagcgtcatgtggtacacttgcggtgactgcgcg gtccgtgtgccgcttgagaaaggcgcccccatccgttgccagaagtgcggtgcgcgtgtt ctgtacaaggagcgcactaagagaatggttcagttcgaggctcgctaa

DBGET integrated database retrieval system