KEGG   Spongiibacter nanhainus: I6N98_04825
Entry
I6N98_04825       CDS       T07977                                 
Name
(GenBank) hypothetical protein
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
snan  Spongiibacter nanhainus
Pathway
snan00333  Prodigiosin biosynthesis
snan01100  Metabolic pathways
snan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snan00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    I6N98_04825
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QQD19182
UniProt: A0A7T4R2W7
LinkDB
Position
complement(1064169..1066568)
AA seq 799 aa
MLSTASSIQWLNASGDEATPDDTLGGKAQGLRRLSQWGLTVPNGFVILNAERGIYPLNLE
ECYRQLGSGKVAVRSSALGEDGANTSFAGQYESVLNVEGLEALHRAIDHCVESLSSQRAS
AYQQQQRSTNLDHTIQMNVLVQTMVEASAAGVVFTVDPVSGRHDRLVVDAIQGLGEALVS
GEATPDHYEFDRDGQLVYSELIGDTPILSEALCKTLCNQAQQAVAKAGHPLDLEWAIDQR
GQIFWLQARPITTIGSDLNELDTPIKPDDVVTRCNVGEMMPGASCPLTFSTTGRGIENGM
QHMHVSYAGRPSVNDEWTQIAMSHGRLFINLSGSLAAAATVLGVDAKSMGYSVCGGLVEE
LKEPPKKSWPRRLLGTLRLLRYLQTADSAIAKFAQKAGTFSLPVSGTSHELAAALDSKLP
FYSEANAVHLQSSTTSGFASNILQAMISGGQESTPAQQAEAARLMAGANGVESAVLVEQL
DAITDQIADSPTEAQLFVDASPTDAIDCLLNTRPEIRSAYQGFLERHGHRGYRELCMREP
CWADNPESLVATMQASVAARLSGAAKSTRPPAVDVSSLSRGLRWILPKAHNAIRRREATK
SLLVDIANRFKRCYRALGQQLVREGKLEDADQVFFFTHDELMTFVQGKADVATWQQKTKA
RRVALEFQNRLEFEEICVGKPVPIDTRLRNQHQDGAIVGRPVSSGIVEATARVAFTVAEA
AALKPGEILVAPITDVGWTPYFNMISGLITDVGSSVSHGAVIAREYGLPAIVNTRVATQR
IKTGDKVHLNADTGVVTLP
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgctcagcacagcgtcaagcatccaatggctgaatgccagcggcgacgaagcaacacca
gacgacaccttaggcggtaaggcccagggcctgcggcgtttaagtcaatggggactcacg
gtacccaatggttttgtgatcttaaatgccgagcgcgggatctaccccttaaacctggaa
gaatgctaccgccaattagggagcggcaaggtcgctgtgcgctcttcagcgctcggggag
gacggcgccaatacttcgtttgcgggccagtacgagagcgtcctcaatgtcgagggcctg
gaggcattgcatcgcgccatcgaccattgtgtagagtccctaagcagtcagcgggcaagc
gcctatcagcaacaacagcgcagtaccaacctggatcacaccattcagatgaatgtgctt
gtacaaaccatggtagaggcaagtgcggccggcgtcgtgttcaccgtggacccggtttcc
gggcgccacgaccggcttgtggttgacgcgatacaggggcttggagaagccctggtcagc
ggcgaagccacccccgaccactacgagtttgatcgcgacggccagctggtctattcagaa
ttgattggcgacacgccgatactcagcgaagcgctgtgcaagacgctgtgcaatcaggcc
cagcaggctgtggcgaaagccggccaccccctggacctggaatgggctatcgatcagcga
ggccagattttttggctacaagcccgccccatcaccaccattggctcggatctgaatgag
ctggatacccccataaagccagacgacgtggtcacccgctgcaacgtcggtgaaatgatg
cctggcgcaagctgccccctcaccttctcgaccactggacgcggtatagaaaacggcatg
cagcacatgcacgtcagctatgcaggccgcccttcagtcaacgacgagtggactcaaatc
gctatgagccacggcaggctgtttatcaatctcagtggctcactggctgcagccgccact
gtgctaggagtcgatgcaaagtcgatgggctacagtgtctgcggcggcttggtcgaggag
ctaaaagagccgcccaaaaaaagctggccacggcgactactgggtactctgcgcctactt
cgttacttacaaactgccgacagcgccatcgctaaattcgcccaaaaggccggcactttc
tcgttgccggtttcaggaacaagtcatgagttggctgcagccctggatagcaagctgcca
ttttactccgaagccaacgcggtacatttacaatcatccaccacctcaggctttgccagc
aatattttgcaggcaatgatttccggcggtcaggaaagcacgccggcgcaacaggccgag
gctgcccggttaatggctggagctaatggcgtagaaagcgctgtgctggtggaacaactg
gacgccatcaccgaccagattgccgactcacccactgaggcgcaattgtttgtcgatgcc
agccccaccgatgccatcgactgcttactgaacaccagaccagagattcgctccgcctac
caggggtttctagagcgccacggtcatcgcggctaccgagagctgtgtatgcgcgagccc
tgctgggcagacaatcccgaaagccttgtcgcaacaatgcaggcctccgtcgcggcccgc
ctcagtggtgctgccaagagtacacgaccccctgcggtagatgtaagcagcttaagcaga
gggctgcgctggatcttacccaaagctcataatgctattcgccgccgtgaggccaccaag
tcattactggtggatatcgccaatcgctttaagcgctgctatcgggcactgggacagcag
ttggtaagggaaggaaagttagaggatgccgaccaagtattcttcttcacccacgatgaa
ctgatgacctttgtccaaggtaaggcggacgtcgccacctggcagcaaaaaaccaaggca
agacgtgtagcgctggaattccagaaccgtctggagtttgaggaaatctgtgtgggtaag
cctgtgccgattgacactcgcttgcggaatcagcaccaagacggcgccattgtgggccga
ccggtttcctccggcatcgtcgaagccaccgccagagtggcctttactgtcgccgaagcc
gctgctctaaagcccggagaaatcctggtcgcgcccatcaccgacgttggctggacaccc
tactttaatatgatctctggattgattaccgacgtcggcagctcagtatcccacggcgcg
gtcatcgcccgggaatacggcttgcccgccatcgtcaatactcgggttgccacccaacgg
ataaagacgggcgacaaagtccacctcaatgccgacaccggcgtggtgacacttccctag

DBGET integrated database retrieval system