KEGG   Streptomyces nojiriensis: JYK04_04016
Entry
JYK04_04016       CDS       T07326                                 
Name
(GenBank) Putative polyketide cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
snf  Streptomyces nojiriensis
Pathway
snf01056  Biosynthesis of type II polyketide backbone
snf01100  Metabolic pathways
snf01110  Biosynthesis of secondary metabolites
Module
snf_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:snf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    JYK04_04016
Enzymes [BR:snf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     JYK04_04016
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: QTI46205
LinkDB
Position
4315524..4316477
AA seq 317 aa
MPSELRTSEHEIKIAGPAENVYRLLAQAEKWPQLFPPNIYVDHVERGEREERIRIWATAG
DTVKHWTSHRTLDPDKLRIGFRQEVSTHPVAAMGGSWQVEALPSGETLVRLSHDFRAADD
DSLTWLEEVVDRNSRSELDSLKALAESRDAAADELTCSFEDTVQIRGAAQDVYDFIYEAN
LWADRLPHVITVRLDEPTPGVQTLEMDTLSKDGSSHTTKSHRVGLAPHRIAYKQTTLPAL
ITLHTGHWTFTPNDDGVAASSQHTFTVNTDNIAKVLGADATVQDAIAYVRTALSTNSKAT
LGIAKEYAEGLAGAGRS
NT seq 954 nt   +upstreamnt  +downstreamnt
atgccgtccgaactgcgtacatccgagcacgaaatcaagatcgcgggaccggccgagaac
gtctaccgcctgctggcgcaagcggagaagtggccccagctgtttccgccgaacatctac
gtcgaccatgtggagcgcggcgagcgcgaagaacgcatccgcatctgggcgacggcaggc
gacaccgtcaagcactggacctcgcaccgcaccctggacccggacaagctccgcatcggc
ttccggcaggaggtcagcacccatcccgtggccgccatggggggatcctggcaggtggag
gccctcccttccggagagaccctggtgcgcctgagccacgacttccgggcggccgacgac
gacagcctgacctggctcgaggaggtcgtggaccgcaactcccgctccgaactcgactcc
ctcaaggcactggccgagtcgcgggacgcggccgctgacgagctgacctgctccttcgag
gacacggtgcagatcaggggggccgctcaggacgtgtacgacttcatctacgaagcgaac
ctgtgggcggaccggctgccccacgtgatcacggtgcgcctggacgagccgacaccgggg
gtgcagaccctggagatggacacgctgtccaaggacggcagcagccacaccaccaagtcg
caccgcgtgggcctggctccccaccggatcgcctacaagcagaccacgctgcccgcgctg
atcacgctgcacacgggtcactggaccttcacgccgaacgacgacggcgtcgcggcgtcc
tcgcagcacaccttcacggtcaacacggacaacatcgccaaggtgctcggagcggacgcg
acggtgcaggacgcgatcgcatacgtacgcaccgcgctcagcaccaacagcaaggcgacc
ctcggcatcgcgaaggagtacgcggaaggactcgccggggcaggccgttcatga

DBGET integrated database retrieval system