Streptococcus nidrosiense: AAFQ93_07545 Help Entry AAFQ93_07545      CDS       T10825                                  Name (GenBank) chorismate mutase   KO K04516   chorismate mutase [EC:5.4.99.5] Organism snid  Streptococcus nidrosiense Pathway snid00400   Phenylalanine, tyrosine and tryptophan biosynthesis snid01100   Metabolic pathways snid01110   Biosynthesis of secondary metabolites snid01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:snid00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     AAFQ93_07545 Enzymes [BR:snid01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      AAFQ93_07545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 BEN Osmo_CC Motif Other DBs NCBI-ProteinID:  XHB96795 LinkDB All DBs Position complement(1597545..1597811) Genome browser AA seq 88 aa AA seqDB search MDLDIIRQEIDQIDDQIVKLLEERMHLVEGVVAYKKASGKPILDTKREEAIFEKVRSRVS NKKYEESIVAIFSDILKRSRDYQDKNIK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggatttagatattattagacaagaaatcgatcagattgatgatcaaatcgtgaagctc ttggaagaaagaatgcatcttgtggaaggcgtagttgcttataaaaaggcttcagggaaa ccgattttggacaccaaaagagaagaggctatctttgaaaaagtcagaagtcgtgtcagc aataaaaaatacgaagagtcaattgtcgcgattttttcagacattctcaaacgttcgcgc gattatcaggataaaaacatcaaatga

DBGET integrated database retrieval system