KEGG   Starkeya novella: Snov_3597
Entry
Snov_3597         CDS       T01258                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K17364  dihydromethanopterin reductase [EC:1.5.1.47]
Organism
sno  Starkeya novella
Pathway
sno00790  Folate biosynthesis
sno01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Snov_3597
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     Snov_3597
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-ProteinID: ADH90869
UniProt: D7AA82
LinkDB
Position
complement(3793711..3794118)
AA seq 135 aa
MADIRAMCAVGLSGQLGLRGSLPWEGRTEPEFVADVARFFDATRGHVLLAGPATKASIPD
FAYRDRTIVEIRSTEDPEAMIAAFPGRVIYIGGGPAVWASYAHLIRHWDVTRLPYDGEAD
RWFDPAWLTTGMGNG
NT seq 408 nt   +upstreamnt  +downstreamnt
atggccgatattcgcgccatgtgcgccgtcgggctgagcggccagctcggcctgcgcggc
agcttgccctgggaggggcggacggagccggaattcgtggcggacgtcgcccggttcttc
gacgccacgcgcggccatgtgctgctggccggccccgccaccaaggcctccattccggat
ttcgcctatcgggaccgcaccatcgtcgagatccgctccaccgaagatccggaggcgatg
atcgccgccttccccggacgggtgatctatatcggcggtgggccggcggtgtgggcgagc
tatgcgcacctgatccggcattgggacgtcacgcgcctgccctatgacggcgaggccgat
cgctggttcgacccggcctggttgaccacgggcatgggcaacggctga

DBGET integrated database retrieval system