KEGG   Streptomyces noursei: SNOUR_39820
Entry
SNOUR_39820       CDS       T04806                                 

Name
(GenBank) hypothetical protein
  KO
K21146  vitamin D 1,25-hydroxylase [EC:1.14.15.22]
Organism
snr  Streptomyces noursei
Pathway
snr00100  Steroid biosynthesis
snr01100  Metabolic pathways
snr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SNOUR_39820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:snr00199]
    SNOUR_39820
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.22  vitamin D 1,25-hydroxylase
     SNOUR_39820
Cytochrome P450 [BR:snr00199]
 Cytochrome P450, bacteria type
  CYP105 family
   SNOUR_39820
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ANZ21192
LinkDB
Position
8926110..8927330
AA seq 406 aa
MTDIATTPQATDAPAFPSDRTCPYRLPEGYAKLRDTPGPLHRVTLYDGRQVWVVTKHEAA
RKLLADPRLSSRRTDANFPATSPRFEVVREGRPAFIGMDPPEHGPKRRMTISEFTVKRIK
GMRPEVEEIVHGFLDEMLASGPPADLVSQFSLPVPSMVICRLLGVPYADHDFFQDASKRL
VQATDVASASAARQDLVRYMDALITACQAEPRPGLVSTLVTEQLAKGEIDREELASTAML
LLIAGHETTASMTSLSAITLLEHPEQYAALREDRSLIPGAVEELLRYLAIADIAGGRIAL
ADIEIEGQLIRAGEGVIVVNSIANRDGSVYEDPDSFDVRRSARHHLSFGFGVHQCLGQNL
ARLELEVILNALMDRVPTLKLAVPVEQLKLRPGTTIQGVNELPVTW
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaccgatatcgccacgacgccccaggccacggatgcgcccgccttccccagcgaccgg
acctgcccctaccggttaccggagggctacgccaagttgcgggacacccccgggcccctg
caccgggtgaccctctacgacggccgccaggtatgggtggtgaccaagcacgaggcggcc
cgcaaactgctcgccgatccgcgcctgtcctccaggcgcacggatgccaacttccccgcc
acgtcaccgcgcttcgaggtggtccgggaaggccggccggcgttcatcggcatggacccg
cccgagcacggccccaagcggcggatgacgatcagcgagttcaccgtcaagcggatcaag
ggcatgcgcccggaggtcgaggagatcgtgcacggcttcctcgacgagatgctcgcctcg
ggcccgcccgccgacctggtcagtcagttctcgctgccggtgccgtccatggtgatctgc
cgactgctcggcgtgccctacgccgaccacgacttcttccaggacgcgagcaagcgtctg
gtgcaggccacggacgtggcgagcgcctccgccgcgcgccaggacctcgtgcgctacatg
gacgcactcatcaccgcctgtcaggccgagccccggccggggctcgtgagcaccctggtc
accgagcagctcgccaagggcgagatcgaccgtgaggaactggcctcgacggcgatgctg
ctgctcatcgccggtcacgagacgaccgcgtcgatgacctccctcagcgcgatcaccctg
ctggaacaccccgagcagtacgcggcgctgcgcgaggaccgcagcctcatacccggtgcg
gtggaggaactgctccgctacctggccatcgcggacatcgccggcgggcgcatcgccctg
gccgacatcgagatcgagggccagctcatccgggccggcgagggcgtcatcgtcgtcaac
tccatagccaaccgcgacggttcggtgtacgaggaccccgactccttcgacgtccgccgc
tccgcgcgccaccatctgtccttcggcttcggtgtgcaccagtgcctggggcagaacctc
gcccgcctggagctggaggtcatcctcaacgcgctgatggaccgcgtcccgacgctcaaa
ctggccgttccggtcgagcagttgaagctgcgaccgggcaccacgatccagggcgtcaac
gagctcccggtcacctggtga

DBGET integrated database retrieval system