KEGG   Spinacia oleracea (spinach): 110781882
Entry
110781882         CDS       T05137                                 
Name
(RefSeq) anthocyanidin 3-O-glucosyltransferase 2-like
  KO
K15775  betanidin 6-O-glucosyltransferase [EC:2.4.1.-]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00965  Betalain biosynthesis
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    110781882
Enzymes [BR:soe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     110781882
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 110781882
NCBI-ProteinID: XP_021841626
LinkDB
Position
Unknown
AA seq 487 aa
MELVFVPTPGMGHLLSAVEVSKLIIQRDRRISILILIIKVPMTSSILDSFVESQSRDNPY
PTRLTFITLPPLSNCPDPSSFSFFQTLITLQKPLVKQAVTDRISKVGSPALAGFILDMFC
TNIMEVADEFMVPSYIFFTSGASLLNFIFLFQKLEDDEGVDTVTKFNDPEIEFDVPGFVN
QVNGKVVPVVFLEKEGGSSMIIDHARRFKKSNGIIVNTFTELESVGVEALFDQVSKNIIP
AVYPVGPILELESKTRGGSQGESQDKILQWLDDQPSSSVVFLCFGSMGCFDADQVKEIAN
GLEKSGHRFLWSLRKPPPEGKVGMPTEHETFVDVLPDGFLERTAERGKMIGWAPQVSILS
HQAVGGFVSHCGWNSTLESIWFGVPMATWPLYAEQQLNAFELVKELGLAVEIRMDYRRDW
KTKKANFTVTAEEIENGVKKLMSLDEETKKKVREMSEKGKKALEEGGSSHMWLGRFIEDV
FTNVASN
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagctagtatttgttccaacgccgggaatgggccaccttctctccgccgtagaagta
tcaaaactcatcatccaacgcgaccgtcgcatttctatactcatcctcattatcaaagtc
cccatgacttcctccatactcgactcattcgtcgagtctcagtcacgtgacaacccttac
ccgacccgactcaccttcatcaccctcccgcctctctccaactgtcctgacccttcttcg
ttttccttcttccagaccctcattactcttcagaagcctcttgttaagcaagctgttacg
gatcgaatcagcaaagtcgggtcgcccgctcttgccgggtttatcctcgacatgttttgc
actaacataatggaggttgctgatgagttcatggtcccctcctatatcttctttacttcc
ggagctagtctcttgaatttcattttcctttttcaaaagttggaagacgatgaaggagtt
gacactgtgaccaagttcaacgacccggaaatcgagtttgatgtacccgggttcgtgaac
caggtcaatgggaaggttgtacccgtggtgtttctcgagaaggaaggtgggtcctccatg
ataatcgaccatgcgaggaggtttaagaaatcgaatgggataatagttaatacattcacg
gagctggaatcggttggtgtagaagctctgttcgatcaagtgagtaagaatatcatacct
gctgtttatcccgtgggtcccatcttggagctagagagtaagacccgaggtgggtcccaa
ggtgaaagtcaagacaagatattgcaatggctagatgatcagccttcttcctccgtggtg
ttcctctgttttgggagcatgggatgttttgatgcagaccaggtgaaagagatagctaac
ggtctggagaaatctggacatcgattcttatggtccttaagaaagccacctcctgaaggt
aaagtcggtatgccaaccgagcacgaaactttcgtggatgttttacccgacgggtttctc
gaacgcacggcggagagagggaaaatgattggttgggcaccgcaagtgtcaatccttagc
caccaggccgtcggtgggtttgtgtcgcattgtgggtggaactcgactttggagagtata
tggtttggggttccgatggcgacatggccgttgtacgcggagcaacaactgaatgcgttc
gagctggtgaaggagctgggattagcggtggagattaggatggactatcggcgagattgg
aaaacaaaaaaggcaaattttacagtaacggcggaggagattgagaatggggtgaagaag
ttgatgagtttggatgaagagacgaagaagaaagtaagggagatgagtgagaaaggtaag
aaagcattagaagagggtggatcttctcacatgtggttgggtcgttttattgaagatgtg
tttactaatgttgcttcaaattga

DBGET integrated database retrieval system