Spinacia oleracea (spinach): 110789589 Help Entry 110789589         CDS       T05137                                  Name (RefSeq) 14-3-3-like protein   KO K06630   14-3-3 protein epsilon Organism soe  Spinacia oleracea (spinach) Brite KEGG Orthology (KO) [BR:soe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:soe03400]     110789589   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:soe04147]     110789589 DNA repair and recombination proteins [BR:soe03400]  Eukaryotic type   Check point factors    Other check point factors     110789589 Exosome [BR:soe04147]  Exosomal proteins   Proteins found in most exosomes    110789589 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  14-3-3 Pox_F16 Motif Other DBs NCBI-GeneID:  110789589 NCBI-ProteinID:  XP_021849979 UniProt:  A0A9R0IKU6 LinkDB All DBs Position 6:complement(95372428..95372821) Genome browser AA seq 94 aa AA seqDB search MVEFMEKVVTAASEGEELTVEERNLLSVAYKNVIGARRLIEQKEESHGNENHISVVRDYR SRIEKELSDICDGILKLPDTKLVSAASSGDSKVL NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggttgagttcatggagaaggtggttaccgcggcttcggaaggggaggagctcacggtg gaggagcgaaacctcctctccgtcgcctacaaaaatgtcatcggagctcgtcgtttgatc gagcagaaggaggagagtcacggcaacgaaaaccacatctctgtcgttcgcgactacaga tctcgcatcgagaaggagctctctgacatttgcgatggaatcttgaagcttccagatact aagcttgtttctgctgcaagttccggtgattccaaggtgttgtag

DBGET integrated database retrieval system