KEGG   Spinacia oleracea (spinach): 110790835
Entry
110790835         CDS       T05137                                 
Name
(RefSeq) scopoletin glucosyltransferase-like
  KO
K15774  betanidin 5-O-glucosyltransferase [EC:2.4.1.-]
Organism
soe  Spinacia oleracea (spinach)
Pathway
soe00965  Betalain biosynthesis
soe01100  Metabolic pathways
soe01110  Biosynthesis of secondary metabolites
Module
soe_M00961  Betacyanin biosynthesis, L-tyrosine => amaranthin
Brite
KEGG Orthology (KO) [BR:soe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    110790835
Enzymes [BR:soe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     110790835
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 110790835
NCBI-ProteinID: XP_021851293
LinkDB
Position
Unknown
AA seq 486 aa
MGAKPEELHIVFFPFMAHGHMIPTLDIARLFAARNKVKVTIITTPLNVSTFSKVIQSSKG
IEASINIEIFRFPAREAGLAEGLENMEQVMRPEFINKFFKAADLLSEQLEQYLEKVRPNC
LVADMFFPWATDCAAKFNIPRLVFHGFSCFSLCAQEIIRLHEPFKNVSSDQQTFLLPSLP
HEIQLTGLQISEDLRKSDETEFKRRMDKIKESELESYGVIVNSFYELEPDYANFFRKELG
RRSWNIGPVSLSNKSKEESIDEHECLKWLSSKKPNSVIYICFGSTVSFIAPQLHEIAVAL
EITGQEFIWVVRNNADNIRKNEEWLPPGFEQRTEGKGLIIRGWAPQVLILEHEAIGAFVT
HCGWNSTLEGISAGVPMVTWPIFADQFYNEKLVTQILKTGVPVGAKKWSRIPSIEYLINQ
DAIQKALTEIMVGKEAEERRNRAKKLKEMAWKAVEEGGSSQSEITTLIKELRSYDPFKKN
NSMLTV
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgggtgctaaacctgaagaacttcacatagttttcttcccattcatggcacatggccac
atgattccaacccttgatatagcgagactctttgcagctcgcaataaagtgaaggtgacc
attatcaccacccctctaaatgtctccaccttctcaaaggtcatccaaagcagcaaggga
attgaagcctcgattaacattgagatattcaggtttccagcaagggaagctggcctggct
gaaggactcgagaacatggaacaagtaatgagacctgagtttatcaacaagtttttcaaa
gctgcagatttgctaagtgagcaactcgagcagtacttggagaaggtcagacccaactgc
cttgttgctgacatgttcttcccatgggcaactgattgtgcagctaagttcaacatccct
aggctagtcttccatgggtttagctgcttttccctttgtgctcaagaaattatcaggcta
catgagccctttaagaatgtgtcttctgaccaacagacattccttcttccttcccttccc
catgagatacagttaacaggactgcagatctcggaagatttaaggaaaagtgacgaaacg
gaattcaaaaggagaatggataagatcaaggaatcagagctcgagagttacggagtgatt
gttaacagcttttatgagttggaacctgattatgcaaattttttcagaaaagaattgggg
aggaggtcatggaatataggtcctgtttcactaagcaacaaaagcaaagaggagtcaata
gatgaacacgagtgcttgaaatggcttagctcaaagaagcctaattcagtaatttacatt
tgttttgggagcacagtaagctttatagctcctcaactgcatgagattgcagtggctcta
gaaatcacagggcaagaattcatttgggtcgtgaggaataatgcagacaatataagaaag
aatgaagagtggttgccacctggattcgaacaacggacagaaggcaaaggcctgataata
agaggatgggctccacaggtgttaatcttggagcatgaagccattggagcttttgtgact
cactgtggctggaactcaacactagaagggatttcagctggtgtaccaatggttacatgg
cctattttcgctgaccaattctataacgaaaaattggtgactcaaattttgaagactggc
gtccctgtcggggctaaaaagtggagtagaattccttcaatagagtatctcatcaaccag
gatgctatacagaaagcattgacagaaataatggtgggaaaagaggcagaagagaggaga
aacagagcaaagaagctcaaggaaatggcatggaaggctgttgaagaaggtggttcttca
caatctgaaataacaacattgataaaagaattaagaagttatgatcccttcaagaagaac
aatagcatgttaacagtttaa

DBGET integrated database retrieval system