KEGG   Solanum tuberosum (potato): 102602070
Entry
102602070         CDS       T02981                                 
Name
(RefSeq) (-)-camphene/tricyclene synthase, chloroplastic-like
  KO
K21925  (-)-camphene/tricyclene/(4S)-limonene/myrcene synthase [EC:4.2.3.117 4.2.3.105 4.2.3.16 4.2.3.15]
Organism
sot  Solanum tuberosum (potato)
Pathway
sot00902  Monoterpenoid biosynthesis
sot01100  Metabolic pathways
sot01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sot00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    102602070
Enzymes [BR:sot01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     102602070
    4.2.3.16  (4S)-limonene synthase
     102602070
    4.2.3.105  tricyclene synthase
     102602070
    4.2.3.117  (-)-camphene synthase
     102602070
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth RAP
Other DBs
NCBI-GeneID: 102602070
NCBI-ProteinID: XP_006351844
LinkDB
Position
Un
AA seq 590 aa
METILTANMGRVIPKISSSFSSSSSSLADGDTAMKVEPPLLRRTGNYQPPIWDFQFIQSL
HNPYVGDKYMNRFNNLKEEMKKNLMLMVEGSIEELDVKLELIDNLERLGVSYHFKDEIMQ
ILKSIHDQISSTDNSLYSTALKFRLLRQHGFHISQDILNDFKDEQGNFKQSLCEDIKGLL
QLYEASILSTESETSTLLESANTFATSHLKNYLHNLNGDHPDNPTVEQVRHALELPLHCK
MLRVETRWYIDIYEKIPNANPLLLELAKLDFNIVQATDQQDLKNLSRWWKTSWLAEKLPF
TRDRIVESFLWIAGMMFEPQKNEYCRTMLTKVIAMVTVIDDIYDVYGTLDELEIFTHAVQ
RMDVKAVDQLPDYMKVCYLALFNTFTEIAYEVLKEQGINVMPYVTKSWADLCESYLREAR
WYHNGYKPSLEEYMENGWISIGGPVVLVHTLFLVTNPITKEALDSLTNYPDIIRWSSTVI
RLADDLGTSSDEMERGDVPKSIQCYMNEKDVSEEDARKHINLLIKETWKLMNTVQNNNSL
FSETFIGCAVNGARTSQTIYQHGDGYGIQNSHTKNRICKLFFEPITISIP
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggagacaatattgacggccaacatggggagggtaatacctaaaatttcctcttcattc
agctcatcatcatcatcactagctgacggtgacactgccatgaaagttgaaccaccactg
cttaggcgtacagggaattaccagcctcctatttgggattttcaatttattcagtcgcta
cacaatccatatgtgggagataagtatatgaatcgttttaacaatctgaaggaggaaatg
aagaagaatttgatgctaatggttgagggatcaatagaagaactagatgttaagttggag
ttgattgataatttagaaaggcttggagtgagttaccactttaaggatgaaattatgcaa
atattgaagagcatacatgaccaaattagtagtacagataattcattatactctacagcc
ttgaagtttaggctcctcagacaacatggttttcatatctctcaagatatactgaacgat
ttcaaggatgagcagggtaacttcaagcaaagtctttgtgaagatataaaaggattgtta
caattatatgaagcttcaattctctctacggaatctgaaacctctactttattggagtcc
gccaatacatttgcaacgtcacatctaaagaattatttgcacaatttaaatggtgatcat
ccagacaatccaacagtggagcaagtgcgccatgccctagaacttcctttgcattgcaag
atgttgagagttgagacaaggtggtacattgacatttatgagaaaatcccaaatgctaat
cctcttctgctagagcttgctaaattggatttcaacattgtgcaagcaacagaccaacaa
gatttaaaaaatctatcaaggtggtggaagacgtcatggcttgcagaaaaattgccattt
acaagggatagaattgtggaatctttcttatggatagctggcatgatgtttgaacctcaa
aagaacgaatactgtcgaacaatgttgacaaaggtcattgctatggttacagttatagat
gacatttatgatgtttatggcactcttgatgaattggaaatcttcactcatgctgttcaa
agaatggatgtaaaagcagtggatcaacttccagattatatgaaagtatgttaccttgca
ctcttcaacactttcactgaaattgcgtacgaagttctcaaagagcaagggatcaacgtt
atgccctacgttacaaaatcatgggcagatttgtgtgaatcgtacttacgagaagcaaga
tggtaccacaatggatataaaccaagtctggaagaatacatggaaaatggatggatctca
attggaggaccagtggtattagtccatacattgttccttgtcacaaatccaattaccaaa
gaggccttggattccttaaccaattatcctgacattattcgatggtcttctactgttatt
cgtttagccgatgatttggggacatcctcggatgaaatggaaagaggtgacgttcccaag
tcaattcaatgttacatgaatgagaaggatgtttcggaagaagatgcaagaaaacacatc
aatttattgataaaggagacatggaaactgatgaacacagttcaaaataataattcatta
ttttctgaaacattcattggatgtgcagtaaatggtgcaagaactagtcagacaatttac
cagcatggagatggctatgggattcaaaattctcatacaaaaaatcgcatttgtaaatta
tttttcgagcccatcacaatttcaattccataa

DBGET integrated database retrieval system