KEGG   Spathaspora passalidarum: SPAPADRAFT_154762
Entry
SPAPADRAFT_154762 CDS       T03101                                 
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
spaa  Spathaspora passalidarum
Pathway
spaa04111  Cell cycle - yeast
spaa04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPAPADRAFT_154762
   04113 Meiosis - yeast
    SPAPADRAFT_154762
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spaa03400]
    SPAPADRAFT_154762
DNA repair and recombination proteins [BR:spaa03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    SPAPADRAFT_154762
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 18871000
NCBI-ProteinID: XP_007376287
JGI: 154762
UniProt: G3AQG2
LinkDB
Position
Unknown
AA seq 491 aa
MTFIAIIDSKSHHLMWSKSILSLSAISEFIKFVITKNSFSISAVNNSNTSHAEIIFKSSF
FNEYHVDFSGILPEGYEEGIEDIDSDDQSSYSFIVNSRHLATVFRTIEPSTLLYVCFKIN
WRIDSSISQRYKLSIEIKTKKLIIKKYQTSYQPVLRGNMHIVQSYKKQLYDQPHDSFDGP
NRINHLVIDQLIPKQFLEMVPPSAEDFKIDIKNGKISFSGYTKQIIKDRDYLKQPMAVTV
TISLEDLIDSNLITTGTDPIKKCINFRLRDFKNFLNLINFFTSSNSQKDQFDENYMTLPS
ADNFDMFFRNAGDPILFELQNSNHVSIQYIQITSDDKATDIEAKQVNVNITKRQSMSLQS
HIIQRIENRDIANSRSTSASPMKNNSSIRTPVSKLPSTSSLRHSIRLPSGWRTPERDLNS
DFGGNNDEEYITYGKEPSPLKHSKTPLKQNSADADTDYSDSEDEPPRKRSNIVEEDGFGP
TQLGNKPKSIF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgacattcatcgctattattgattcaaaatcccaccaccttatgtggtcaaagtcaatc
ctttccttatctgccatttccgaattcataaagtttgtcattaccaagaattctttctca
atatctgccgtcaataacagtaatacatcccatgcagaaataatcttcaaaagtagcttt
ttcaatgaatatcacgttgactttagtggaatactacccgaaggatacgaggaaggtata
gaggatatagattccgatgaccaatcatcatactcattcattgtcaactctcgtcatttg
gcaacagtattcagaactatagaacctagtacattattatacgtctgtttcaagataaat
tggagaatagattcatctataagtcaaagatacaaactttccattgagatcaagacaaag
aaactaattatcaagaaatatcaaacgagttatcagccagtgctacgtgggaatatgcat
attgtacaactgtataagaaacaactatatgatcaaccacatgacagctttgatggtccc
aataggattaatcacttggtgatagatcaactcataccgaagcaatttcttgaaatggta
cctccctcagcagaagatttcaaaatagatattaaaaatgggaaaatcctgtttagtgga
tataccaagcaaatcattaaggatagagattatcttaaacaacccatggcagtaactgtc
actattagtttagaagatttaattgatagtaacttaatcacaaccgggactgaccctatt
aagaaatgtatcaatttccgattacgagattttaaaaatttcttgaatttgattaatttc
ttcacatcttccaattcgcaaaaggatcaatttgatgagaactatatgaccctaccatca
gcagataactttgatatgttctttcgtaatgctggtgatccgattttatttgagctacaa
aatagcaatcatgtttccattcaatatattcaaattacatccgacgataaggcaaccgac
atagaggcaaaacaagtcaatgtcaatataaccaagaggcagagcatgtcattacaatct
cacatcatacaaagaatagagaatcgagatatcgcaaatagcagatcaacatcagcttca
ccaatgaagaataattcactgattcgtacacccgtgagtaaattaccatcaacaagcagc
cttcgtcactcaatacgtttaccaagtggctggagaactcctgaacgtgatctaaattca
gatttcggtggcaacaatgatgaggagtatataacttatggaaaggagccgtctcctttg
aagcatagcaagacaccattaaagcagaattctgcagatgcagatactgactacagtgat
tcagaagatgaaccaccaagaaagcgttcaaatattgtagaggaggatggttttggtcct
acccaacttggtaataaaccaaagtctatattttaa

DBGET integrated database retrieval system