KEGG   Streptomyces pactum: B1H29_13445
Entry
B1H29_13445       CDS       T07142                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
spac  Streptomyces pactum
Pathway
spac01057  Biosynthesis of type II polyketide products
spac01100  Metabolic pathways
spac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spac00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    B1H29_13445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:spac01008]
    B1H29_13445
Polyketide biosynthesis proteins [BR:spac01008]
 Polyketide tailoring proteins
  Others
   B1H29_13445
SSDB
Other DBs
NCBI-ProteinID: AQS71968
UniProt: A0A1S6JJQ7
LinkDB
Position
complement(3296375..3297385)
AA seq 336 aa
MRVTALVSLASVLVIAAPTAFAGGRGEGGTRGSTDQRAEAGGDGTVSVTVGGVVFDRSKN
GSGDSAGALTSPASWSPPPCWYAPKYSPEQLQEHLEPIWEAGSTGHEWDAKQRDKFNADD
EKTGFNKDKSGKGYWWGSYVNRSYPPGWDSCDEDYFWVDTGDAPPANVENAVTPEVLAEL
AYAEIRVPGTEVTLAPAETTKVNLPTWAWLDGAEFKPVSVTASVEAIGIEATATAEPVSL
RIEPGTEDAETHPASGVCEINNGRIGEAYAKGRAEETPPCGVTYLRSSGDGSYPLRATVT
WQIHWTGTGGAGGGLPDGAFGATQDVVVQEIQAVNR
NT seq 1011 nt   +upstreamnt  +downstreamnt
ctgagggttacggcccttgtctcacttgccagtgttctcgtgatcgcggctcctacggcg
ttcgcgggcgggcgtggtgagggcggcacccgcggttcgacggatcaacgggccgaagcc
ggcggtgatggcaccgtctccgtgaccgtgggcggtgtcgtcttcgaccgttcgaagaac
ggcagtggtgactcggctggggcattgacatccccagcatcatggagcccgccaccctgc
tggtatgcccccaaatacagccccgagcagttgcaggagcatctggaaccgatttgggaa
gccggctccacggggcacgagtgggacgccaagcagcgggacaagttcaacgccgacgac
gagaagacgggcttcaacaaggacaagtccggcaagggctattggtggggctcgtacgtc
aacaggagctacccgcccggctgggactcctgtgacgaggactacttctgggtggacacg
ggggacgccccgccagccaacgtcgagaacgccgtaacccccgaggtcctcgccgagctc
gcctacgcggagatccgcgttcccggcaccgaggtgacgctggcacccgcggagaccacc
aaggtgaaccttcctacgtgggcgtggctggacggagccgagttcaagccggtctcggtc
accgcgtccgtggaggcgatcggtatcgaggcgacggccacggcggaaccggtctcactg
aggatcgagccgggcaccgaggacgccgagacgcaccccgcatccggtgtgtgcgagatc
aataatggtcgtatcggtgaggcctacgccaagggcagggcggaggagacgccgccctgc
ggtgtgacttacctgcgttcctcgggcgacggttcatatccgctccgggccaccgtcacc
tggcagatccactggaccggcacgggcggcgcgggcggtggcctccccgacggcgcgttc
ggcgctacccaggacgtcgtcgtccaggagatccaggccgtcaaccgctga

DBGET integrated database retrieval system