KEGG   Streptomyces paludis: DVK44_30960
Entry
DVK44_30960       CDS       T06964                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
spad  Streptomyces paludis
Pathway
spad00333  Prodigiosin biosynthesis
spad01100  Metabolic pathways
spad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spad00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DVK44_30960
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Abhydrolase_3 Abhydrolase_11 Hydrolase_4 Lipase_3
Other DBs
NCBI-ProteinID: AXG81394
UniProt: A0A345HXH0
LinkDB
Position
complement(7015848..7016714)
AA seq 288 aa
MHTIERPAWEPSAPRPPTAGWFHGFGPGADTGRHAAPLRLVCLPYAGGTPSVYRNWAADL
GDGVRVVPVLLPGRGPRAREAPYTAMAPLAADLADALAEHELAHDYALFGHSMGALLAYE
VAHELRDRGLPEPAHLFVSGSKAPHLYGDRADHTLSDADLRQRVRDLGGLGADDTIGSSY
LERRLPVLRADLTVCETYRWAPRTPLNCPMTAFSATRDPLAPAHRMEAWRVHTRGSLLRH
HLEGDHFFLNGPSRPRLLRHIRAELARHLDESGVPGTAARDPLPPAKR
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcacaccatcgagcggccggcgtgggagccctcggctccgcggccaccaaccgccggg
tggttccacggtttcggcccgggcgcggatacggggagacatgccgccccgctgcgtctt
gtctgcctcccgtacgcgggcggcacgccgtccgtctaccggaactgggcggcggacctg
ggcgacggtgtgcgtgtcgtccccgtcctcctgcccggccggggaccgcgcgcccgagaa
gcgccgtacaccgccatggctccgctggccgcggatctcgcggacgcgttggccgagcac
gaactcgcccatgactacgcgctgttcggccacagcatgggagcgctgctggcctacgag
gtcgcccacgagctgcgggaccgcggcctgcccgagccggcacacctcttcgtctccggc
agcaaggcgccgcatctgtacggcgaccgggccgaccacacactctcagacgcggatctg
cggcagcgggtacgcgacctcggaggtctgggcgccgacgacaccatcggcagctcgtac
ctggagcggcgtctcccggtgctccgcgccgacctcaccgtctgcgagacctaccggtgg
gcccctcgcacccccctgaactgcccgatgaccgcgttctccgccacccgtgatccgctc
gcgcccgcgcaccggatggaggcatggcgcgtccacacccgggggtcgctcctgcgccac
cacctggagggcgaccacttcttcctcaacggcccttcgaggccgcgccttctgcgtcat
atccgtgccgaactcgcccgccacctcgacgagtcgggtgttccgggcacggcggcgcgc
gacccactgccccctgcgaagaggtaa

DBGET integrated database retrieval system