KEGG   Saccharomyces paradoxus: SPAR_J02280
Entry
SPAR_J02280       CDS       T08193                                 
Name
(RefSeq) Tah11
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
spao  Saccharomyces paradoxus
Pathway
spao04111  Cell cycle - yeast
spao04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spao00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPAR_J02280
   04113 Meiosis - yeast
    SPAR_J02280
SSDB
Motif
Pfam: CDT1_C DUF4406
Other DBs
NCBI-GeneID: 54631637
NCBI-ProteinID: XP_033767308
UniProt: A0A8B8UUA4
LinkDB
Position
X:509664..511478
AA seq 604 aa
MSGAGKYRKKEPLRVPVIDLNRVSDEEQLLPVVRAVLLQHDTFLLKNYANKAVLDALLAG
LTMKDLPDTSQGFDANFTGTLPLEDDVWLEQYIFDTDPQLHFDRKCENDSLCSIYSRLFK
LGLFFAQLCVKSVVSSTELQDCISSSHYATKLTRYFNDNGNTHDAAEAGATVLPTGDDFE
YLFERDYVTFLPTGILTIFPCAKAIRYKRSTMAATDNSWISIDEPDCLLFHTGTLLARWS
QGMHTTSPLQIDPRANIVSLTIWPSLTTPIGGGGEGTIANQLLEEQIKAFPKVAQHYYPR
ELSILRLQDSMKFCKELFTVCETVLSLNALSRSTGVSPELHVLLPQMSSMMKRKIVQDDI
LKLLTIWSDAYVVELNSRGELTMNLPKKDNLTTLTNKSRTLAFVERAESWYQQVVASKND
IIIDVPIFRINKRRSSNNLKTISSSKVQTKSSDTNALSNSRYLANTKENFMYKEKMPDSQ
ANLMDRLRERERRSAALLSQRQRRYQQFLAMKMTQVFDILFSLTWGQPYTETYLSSLVVD
SLQDSNNPIGTKEASEILAGLQGILPMDISVHQVDGGLKVYRWNNLDKIRFSKLLEIHKS
KQQD
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgagtggtgcagggaagtacaggaaaaaggagccgttacgcgtgcctgtgatagatttg
aatagagtttcagacgaagagcagctgttgccagtggtgagggcagttttactgcagcat
gacacctttttgttgaaaaattatgctaacaaagctgttcttgatgcgctgctggcgggg
cttacgatgaaggacctgcctgacacgagccaaggcttcgatgcgaactttacgggcaca
ttaccgctagaagatgatgtttggctggagcagtacatattcgacactgatcctcaattg
cacttcgaccggaagtgcgagaatgattcactgtgctctatatatagcaggctgttcaaa
ctgggtttgtttttcgctcagctgtgcgtaaaaagcgtggtttccagcacagaattgcaa
gactgtatcagtagttctcactatgcgaccaaactgacccgatattttaatgacaatggt
aatacacatgatgctgcggaagcgggtgctaccgtgctgcccactggcgacgatttcgag
tacctgtttgaaagggactacgttactttccttccgacaggcattttgaccatcttcccc
tgtgccaaggctatcagatacaagcgatcgactatggcggccacagacaattcttggata
agtattgatgagcccgattgtcttctgttccacacggggaccttacttgcccgctggtcc
caaggcatgcacactacctcgccactacagatagatcctcgtgcgaacattgtttcgttg
accatctggccttccctaactacgccaatcggtggtggaggcgagggtacgattgccaat
caactgttagaggaacaaatcaaggccttcccaaaagtagctcagcattactacccgcga
gaacttagtattctaagattgcaagattcaatgaagttttgtaaggaactattcactgtt
tgcgaaacagttttgtctttaaatgctctctccagatccacgggggtttcgccggaactc
cacgttttgttacctcagatgtccagcatgatgaaaaggaaaatagtgcaggatgatatt
ttgaagttgctgactatttggtctgacgcatatgtggtggaattgaactctagaggggag
ctgaccatgaatctacccaaaaaggacaacttaacaacgttgaccaataagtctaggact
ttggccttcgtggaaagggcagagtcgtggtaccaacaggtagtagcttccaaaaatgac
attatcattgacgtacccattttcagaattaataaaagaagatcgagcaataatctcaaa
accatttcgagcagcaaagtgcaaacgaaaagttccgacactaatgcactgagtaactcg
agatatttagcgaatacgaaggaaaatttcatgtacaaagaaaagatgcctgattcgcag
gcaaaccttatggacagactgcgtgaaagagagagaagatcagctgcattgctttctcaa
aggcaaaggcgttaccagcagtttctagcaatgaaaatgactcaggtatttgatattctc
ttttcgctgacgtggggccagccctatacggaaacatatctaagctccttagtcgtggac
agcttacaagatagtaacaaccctatcggtacaaaggaggcaagtgaaattttggcgggg
ctacaaggcattttaccaatggacatatctgttcatcaagtggatggtgggttaaaagtt
tataggtggaacaacttggacaaaatcagattttccaagctcttggaaattcacaaatca
aaacaacaagattga

DBGET integrated database retrieval system