KEGG   Saprolegnia parasitica: SPRG_04534
Entry
SPRG_04534        CDS       T04137                                 

Definition
(RefSeq) hypothetical protein
  KO
K22101  dihydroneopterin triphosphate aldolase (PTPS-III) / 6-pyruvoyltetrahydropterin synthase [EC:4.1.2.60 4.2.3.12]
Organism
spar  Saprolegnia parasitica
Pathway
spar00790  Folate biosynthesis
spar01100  Metabolic pathways
spar01240  Biosynthesis of cofactors
Module
spar_M00841  Tetrahydrofolate biosynthesis, mediated by PTPS, GTP => THF
Brite
KEGG Orthology (KO) [BR:spar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPRG_04534
Enzymes [BR:spar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.60  dihydroneopterin triphosphate aldolase
     SPRG_04534
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     SPRG_04534
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-GeneID: 24126973
NCBI-ProteinID: XP_012198844
UniProt: A0A067CJE7
LinkDB
Position
Unknown
AA seq 171 aa
MVSKPTDVYKVFVSKDYMKFNAAHFIAYKGFRERLHGHNYRLSVTIYGHSVGHDGYVLDL
VRSRRARKICKELNEHFIVPIKSDVLTIVVDDTNVQLTTEDGQKFSFPKSDCSILPIVHS
SAEELAIYISGRLIEEFTMNELQARNVFKLEISIAEAENQLASYERHLTYE
NT seq 516 nt   +upstreamnt  +downstreamnt
atggtgtccaagcccactgatgtctacaaggtgtttgtctccaaggactacatgaagttc
aatgcggcccacttcatcgcgtacaagggcttccgcgagcgcctgcatggccacaactac
cgcttgtccgtgaccatttacggccattcggttggccacgacggctacgtgctggacttg
gtcagatcaaggcgcgcgcgcaagatttgcaaggagctcaacgagcactttatcgtgccc
atcaagagcgacgtgttgacgattgtggtcgatgacaccaacgtgcagttgacgaccgaa
gacggccaaaagttcagctttcccaagtcggactgctcgatcttgcccattgtgcactcg
tcggcggaagagctcgccatctacattagcggccgcttgatcgaagagtttacgatgaac
gagctccaggcgcgcaacgtgttcaagctcgaaatcagcatcgccgaggcggagaaccag
ctcgcttcgtacgagcgccacctcacgtacgagtag

DBGET integrated database retrieval system