KEGG   Streptomyces parvulus: Spa2297_21225
Entry
Spa2297_21225     CDS       T04685                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
spav  Streptomyces parvulus
Pathway
spav01057  Biosynthesis of type II polyketide products
spav01100  Metabolic pathways
spav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spav00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    Spa2297_21225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:spav01008]
    Spa2297_21225
Polyketide biosynthesis proteins [BR:spav01008]
 Polyketide tailoring proteins
  Others
   Spa2297_21225
SSDB
Other DBs
NCBI-ProteinID: ANJ09267
UniProt: A0A191V2V2
LinkDB
Position
4644257..4645294
AA seq 345 aa
MPAVARTSVCAAILAGGIVLASCPAAWADIVPGGDGGGSETQVDGGKAGGGISATAGAVV
FDRSNNGAGQTAGPVAAASNWTPPACYYAPKYTPEQLQKTLEPIWQAESTGYQWDAEQRD
RYENGKPYKDFNKDKAGEGYWWDSYVTQGREGDPGALDCEADIFWVDTNDDPPADIPQAI
TPEILAQLAYAEIRVPTTEVDLAPANATKVNLPTWAWLDAAKFKRVSVTASVPLLGVQAT
TTAEPVSVKIDPGTADAQTYPASGVCELAGDRIGEPYAKGKAEQTPPCGVKYLRSSGNGS
YQLRATVTWKIHWTGTGVDNEQTLPDGEFGGDQDVIVQEIQAVNR
NT seq 1038 nt   +upstreamnt  +downstreamnt
gtgccagccgtagcgaggacatcggtgtgtgcggccatactggcgggcggcatcgtgctt
gcctcgtgtccggcggcatgggccgacatcgtgcccggcggtgacggcggggggtcggaa
actcaagtggatggcgggaaggcgggcgggggcatctcggcgacggccggtgctgtggtc
ttcgaccgttccaacaatggtgcgggccagaccgcgggccccgtcgccgccgcctccaac
tggacgcctccggcgtgctactacgccccgaagtacacccccgagcagcttcagaagact
ctcgaacccatctggcaggccgagtcgacgggctaccagtgggacgccgagcagcgcgac
aggtacgagaacgggaagccgtacaaggacttcaacaaggacaaggccggcgagggctat
tggtgggactcctacgtcacccaggggcgtgagggcgatccaggagcgctcgactgcgag
gcagacatcttctgggtcgacaccaacgacgacccgcctgcggacatcccgcaggcgatc
acgcccgagatcctcgcccagctcgcctatgccgagattcgcgtacccacgaccgaagtg
gatctcgcgcccgccaatgccaccaaggtcaacctcccgacttgggcctggctggacgcc
gcgaagttcaagcgcgtctcggtgacggcctccgttcctctgctgggcgtccaggcgacc
accactgcggaacccgtgtcggtgaagatcgacccgggcaccgcggacgcccagacctac
cctgcatccggcgtgtgcgagctggcaggcgaccgcatcggcgagccctatgccaaggga
aaggccgagcagaccccgccgtgcggagtgaagtatctgcgttcctccggcaacgggtcg
taccagctgagggcgacggtcacctggaagatccactggaccggcacgggcgtggacaac
gaacagacccttccggacggcgagttcggtggagaccaagacgtgatcgtccaagagatc
caggccgtcaaccgctga

DBGET integrated database retrieval system