Sphingobium sp. EP60837: EP837_01241 Help Entry EP837_01241       CDS       T04432                                  Name (GenBank) UPF0092 membrane protein   KO K03210   preprotein translocase subunit YajC Organism sphb  Sphingobium sp. EP60837 Pathway sphb02024   Quorum sensing sphb03060   Protein export sphb03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sphb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     EP837_01241  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     EP837_01241  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     EP837_01241  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sphb02044]     EP837_01241 Secretion system [BR:sphb02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    EP837_01241 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YajC MreC Orf78 T2SSM TMEM154 Motif Other DBs NCBI-ProteinID:  ANI77672 UniProt:  A0A173KUT2 LinkDB All DBs Position 1:complement(1263023..1263358) Genome browser AA seq 111 aa AA seqDB search MLITPAFAQTAGEQSSGASMLVQMAPLVLIFVVFYFLLIRPQQKRMKEHKAKIDAVKKGD QVVTGGGLVGKVARVDEHYVDVELAPGMKVKAVKSTLTDVVDPATAKPAND NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgctcattaccccagcctttgcccagaccgcgggcgagcaatcgtccggcgcttccatg ctggtgcagatggcgccgctcgtcctcatcttcgtcgtcttctacttcctgctgatccgc ccgcagcaaaagcggatgaaggagcataaggcgaagatcgacgccgtcaaaaagggcgat caggtggtgaccggtggcggcttggttgggaaggtcgcccgcgtcgatgaacattatgtc gatgtcgaactcgcgcccggcatgaaggtgaaggccgtcaagtccacgctgaccgacgtc gtcgatccggcgaccgccaagcccgcaaacgactga

DBGET integrated database retrieval system