Streptomyces platensis: CP981_26620 Help Entry CP981_26620       CDS       T07341                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism spla  Streptomyces platensis Pathway spla00190   Oxidative phosphorylation spla01100   Metabolic pathways Module spla_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spla00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CP981_26620 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spla00194]     CP981_26620 (atpE) Photosynthesis proteins [BR:spla00194]  Photosystem and electron transport system   F-type ATPase [OT]    CP981_26620 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF441 Motif Other DBs NCBI-ProteinID:  QEV54732 UniProt:  A0AAE6NL02 LinkDB All DBs Position 5977224..5977484 Genome browser AA seq 86 aa AA seqDB search MSAALEMVNLAAGSAKTNVVGNVASIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLI RTNQIMGFAFCEALALIGIVMGFVYQ NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtccgctgctctcgaaatggtcaacctcgccgccggctccgccaagaccaacgtcgtc ggcaacgtcgcctccatcggttacggcctggccgcgatcggccccggcgtcggcgtcggc atcatcttcggtaacggcacccaggccctggcccgtcagcccgaggcggccggcctgatc cgcaccaaccagatcatgggtttcgccttctgtgaggcgctcgccctgatcggcatcgtc atgggcttcgtttaccagtaa

DBGET integrated database retrieval system