KEGG   Streptomyces platensis: CP981_34445
Entry
CP981_34445       CDS       T07341                                 
Name
(GenBank) hypothetical protein
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
spla  Streptomyces platensis
Pathway
spla00253  Tetracycline biosynthesis
spla01057  Biosynthesis of type II polyketide products
spla01100  Metabolic pathways
spla01110  Biosynthesis of secondary metabolites
Module
spla_M00780  Tetracycline/oxytetracycline biosynthesis, pretetramide => tetracycline/oxytetracycline
Brite
KEGG Orthology (KO) [BR:spla00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP981_34445
   00253 Tetracycline biosynthesis
    CP981_34445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:spla01008]
    CP981_34445
Enzymes [BR:spla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     CP981_34445
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     CP981_34445
Polyketide biosynthesis proteins [BR:spla01008]
 Polyketide tailoring proteins
  Oxygenase
   CP981_34445
SSDB
Motif
Pfam: FAD_binding_3
Other DBs
NCBI-ProteinID: QEV57249
LinkDB
Position
complement(7805692..7807158)
AA seq 488 aa
MLACELQLAGARTLVVDRLAEPVDFSKALGVHARTVELLEMRGLATAFLRDAPKLRGGNF
ASLGVPLQFESFDTLHPYALFVPQVRTEELLTERALELGAQLRRGHALTNLGQDEHGVTV
QVEGPDGPYEIDAAYLVGCDGGSSTVRKLLGIDFPGQDPHMFAVIADARFREELPHGEGM
GPMRPYGVMRHDLRAWFAAFPLEPGIFRATVAFFDRPYADRHAPVTENDVRAALTEVAGS
DFGMHDVHWLSRLTDTSRQATRYRDQRVLLAGDACHIHLPAGGQGLNLGFQDAVNLGWKL
GAVLAGTAPEGLLDTYESERRPVAAGVLRNTRAQAVLIDPDPRFEGLRELMIELLHVPET
NRHLAGLISALDVRYDIPGEHPLTGRRVPDLLLDTSEGSRRLSSYFHEARGLLLALPPDR
GQADAITGWKDRVDLVPVHAVRMPGTAPADFTALLIRPDGYVCWAGTPGGGVDGLTEALH
TWFGAPTT
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgctcgcctgtgaactgcaactcgccggggcccgcaccctggtggtggaccgccttgcg
gaaccggtcgatttttccaaggcgttgggcgtgcatgcccgcaccgtggaactgctggag
atgcgcggcctggccacggcctttctgcgggatgccccgaaactgcgcggggggaacttc
gccagcctcggcgtgccgctgcagttcgagtccttcgacaccctgcacccctacgccctg
ttcgttccccaggtccgtaccgaggagctgctgaccgagcgcgctctggaactgggcgca
cagctgcgccggggccatgccctgaccaacctggggcaggacgagcacggcgtgaccgtg
caggtcgaggggcccgacgggccgtacgagatcgacgccgcgtacctggtggggtgtgac
gggggcagcagcaccgtacgcaagctgctcggcatcgacttcccaggccaagatccccat
atgttcgctgtgatcgcggacgcccggttccgggaggagctgccgcacggcgagggcatg
gggcccatgcggccgtacggcgtgatgcggcacgatctgcgcgcctggttcgcggccttc
ccactggagcccggcatcttccgggccaccgtcgccttcttcgaccggccctacgccgac
cggcacgctcccgtcaccgagaatgacgtacgcgccgcgctgaccgaggtggccggcagc
gacttcgggatgcacgacgtgcactggctctcccggctcaccgacacctcacggcaggcc
acccgctaccgggatcagcgggtactgctggcaggggacgcctgccatatccacctcccc
gccggcggccagggcctcaacctcggcttccaggacgccgtcaacctcggctggaagctg
ggcgcggtccttgcgggaacggccccggagggtctgctggacacctacgagtccgagcgg
cgccccgtcgcggcgggtgtgctgcgcaacacccgggcccaggccgtcctcatcgacccc
gacccgcggttcgagggattgcgggagctgatgatcgagctgttgcacgtaccggagacc
aaccgtcatctggcgggcctgatttcggcactggacgtgcgctacgacatccccggcgag
cacccgctgaccgggcgccgggtcccggacctgctgctggacaccagcgagggcagccgc
aggctcagcagctacttccatgaggcccgggggctcctgctagccctgccgccggaccgt
ggacaggccgacgcgatcaccggctggaaggaccgggtcgaccttgtcccggtgcacgcg
gttcggatgcccggcaccgcgcccgccgacttcacggcactgctcatccgcccggacggt
tacgtctgctgggccggtacgcccggcggaggcgtggacggcctgaccgaggcgctgcac
acctggttcggagcccccactacgtaa

DBGET integrated database retrieval system