Serratia quinivorans: E4343_14510 Help Entry E4343_14510       CDS       T05941                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism squ  Serratia quinivorans Pathway squ02024   Quorum sensing squ03018   RNA degradation Brite KEGG Orthology (KO) [BR:squ00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     E4343_14510 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     E4343_14510 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:squ03019]     E4343_14510 (hfq)    03036 Chromosome and associated proteins [BR:squ03036]     E4343_14510 (hfq) Messenger RNA biogenesis [BR:squ03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      E4343_14510 (hfq) Chromosome and associated proteins [BR:squ03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     E4343_14510 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QBX67318 LinkDB All DBs Position complement(3085201..3085509) Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNTPSGGTSNYHHGNNPSAPQQPQQESDDAE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccgttcctgaacgcattgcgtcgtgaacgtgtt ccggtttctatttatttggtgaatggtattaagctgcaaggccagattgagtcttttgac cagtttgtcatcctgttgaaaaacacggtgagccagatggtttataagcacgctatctct accgttgtcccgtcacgcccggtttcgcaccatagcaatactccgagcggcggcaccagt aactatcaccatggtaacaacccgtctgcgccgcaacagccgcagcaggaaagcgatgac gctgaataa

DBGET integrated database retrieval system