KEGG   Serratia sp. AS13: SerAS13_1752
Entry
SerAS13_1752      CDS       T02012                                 
Name
(GenBank) Pyruvate, water dikinase., Phosphoenolpyruvate--protein phosphotransferase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
sra  Serratia sp. AS13
Pathway
sra00333  Prodigiosin biosynthesis
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
Module
sra_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SerAS13_1752
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: AEG27540
UniProt: A0A7U3Z0R8
LinkDB
Position
complement(1903708..1906380)
AA seq 890 aa
MSRSLIVELSGDPMLKHHHLGGKGYSLNHLIKAGLPVPPAFCITVQAYQQFIEATVPGQI
LTKGARGEVRDIILGANVPTSLQQAINDAYQQLGDDASIAVRSSALEEDGQHQSFAGQYD
TYLHVKGAEEVLRKVQSCWASLWAERTAHYSQTHASESEIAVVLQVMVDADAAGVMFTQD
PLTGNADQVVIDSCWGLGEGVVSGQVTTDSFTLDKASANLCDRQIRHKSHYCQRDAQGQV
TLLATPEAKRDIPSLTPEQLRQLVTLARQAQLIYRTELDIEWAVKDNQVWLLQARPVTTQ
AKPAQVIYANPWENDQAIKDRAFFSRMDTGEIVTGLMTPLGLSFCRFYQKHIHGPAIKTM
GLADISDWQIYMGYIQGYVYLNISGSAYMLRQCPPTRDEMKFTTRYATADIDFSHYENPY
GKGVQGWSYVKSGWYWLKQQVHNLRSAANTVEQMIALRQQETRRFLALDLTALSLVELEQ
ELQRVDRFFLDSCAAYMPFFLQSFALYDALAQTCERYLKGRGQGLQNRIKASMNNLRTIE
VTLGIIKMVDKVNRQPALKALFEQHSANELVNILPEDEISRAFWQGDFKDFLFEFGTRGR
QEFELSIPRWNDDPSYLLQVMKMYLQHPVDLQKKLRETERLRHQDSEALFKEMTWVGRFK
LKTLTRLYAVMAERREATRPTFITETWFYRCIMLEVLRRLETQGVVKMSDLPYVDFEQFR
AYMAGKIPAQQAFAQTLLDQNRHQHLLNLHAEEPPLAIIGSYTPKMKTPAADNTAGVFTG
LAASPGKVVGKARVITDLPTQAGELQPNEILVARFTDASWTPLFALAAGIVTDIGSTLSH
SCIVAREFGIPAVVNLKVATQLIASGDTLILDGDSGTVIIQRGEEPDADG
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgagtcgctcactgattgtcgaactctccggtgatccgatgctgaagcatcaccatctg
ggtggtaaagggtattcattaaatcatctaatcaaagccggcctgccggtaccgccggca
ttttgcatcactgtccaggcttaccagcaatttattgaagccacagttcccgggcagata
ttgacgaagggtgccagaggcgaggtacgcgatattattctgggcgctaatgtgcccacc
tctttgcagcaggcaatcaacgacgcttatcagcaattgggcgatgacgcctccattgcc
gttcgttcctcggcattggaggaagacggccaacatcaatcctttgccggacagtacgac
acctatctgcatgttaagggcgccgaggaggtattacgcaaggtgcaatcctgctgggcg
tcattgtgggcagaacggacggcgcactacagccagacgcacgcctcggaaagcgagatt
gccgtggtgttgcaggtgatggtggacgccgatgccgccggggtgatgtttacccaggat
ccactgaccggcaatgccgatcaggtggtgatcgacagctgctggggcctgggagaaggc
gtggtctccggacaggtgaccacggacagcttcactctggacaaagccagtgccaacctt
tgcgatcggcaaatccgccacaaatcgcattactgccagcgggatgctcaggggcaagtg
acgctactggccacccctgaggccaaacgcgatatacccagtttgaccccggagcagctg
cgtcaattggtcaccctggccagacaggcccaacttatttaccgcaccgaactggatatt
gaatgggcggtaaaagataaccaggtctggctgctacaggcacggcctgtcactacccag
gccaagcctgctcaggttatctacgccaatccctgggagaacgatcaggcgatcaaggat
cgggcctttttctcgcggatggacacaggagagattgtcactggattgatgacgccgctg
ggattgtcgttttgtcggttctaccagaaacatattcatggcccggcgattaaaaccatg
ggacttgctgatatcagcgattggcaaatctacatggggtatatacagggctatgtttat
ctgaatatttccggttcggcttatatgctcaggcagtgtccgccgacccgtgatgaaatg
aaattcaccacccgttatgccaccgccgacattgacttcagccattatgagaatccctat
gggaaaggcgtgcaaggctggagctacgtcaaaagtggttggtattggctcaaacagcag
gttcacaatctgcgcagtgccgccaacaccgtcgaacagatgattgctttacgccaacag
gaaacccgccgctttctggcgctggatttaaccgccctgtctctggttgaactggagcaa
gaactgcaacgggttgaccgctttttcctcgacagttgcgccgcttacatgccttttttc
ctgcaatcatttgccctctatgacgccctggcgcaaacctgcgaacgctatctcaaaggc
cggggccagggattgcaaaatcgcatcaaggcgtcgatgaacaacctgcgcaccattgaa
gtgacgctgggtatcatcaaaatggtggacaaggtcaatcgacaacctgcactgaaagcg
ctgtttgaacagcacagcgccaatgaattggtcaacatcttgcccgaagatgagatctcc
cgcgcattctggcagggcgattttaaggatttcctgtttgaatttggcacccgtggtcgc
caggaatttgagttgagtattccgcgctggaatgatgatcccagttatctgttgcaggta
atgaaaatgtatttgcagcacccggtggatctgcaaaagaaactcagagaaacggaaagg
ctgcgtcatcaggacagcgaagcactgttcaaagaaatgacatgggtcggtcgattcaag
ttaaaaaccctgaccaggctatatgccgtgatggccgaacgccgtgaggccacccgcccc
acctttatcaccgaaacctggttctatcgctgcattatgctggaagttctgcgacgcctg
gaaactcagggcgtcgttaaaatgagcgacctcccttatgtcgatttcgagcagttccgc
gcctatatggcgggtaaaatcccggcacaacaggcttttgcgcagacactgctcgatcag
aatcgccaccagcatttattgaacttgcatgctgaagagccgccgttggcgattatcggt
tcctacacgccgaaaatgaaaacccccgcagcggataataccgccggcgtattcaccggc
cttgccgcaagccccggcaaagtggtgggaaaagcgcgagtcattaccgacctgccaacc
caggctggtgagcttcaacccaacgaaatcctggtggcgcgctttaccgacgccagttgg
acaccgttattcgcactggcggccggtattgtcaccgatatcggatccacgctttcacac
agttgcattgtggcacgagagtttggcatccccgccgtagtcaacctgaaagtagccacc
caactgattgccagcggagacactctgatcctcgatggcgatagcggaacggtcattatc
caacgcggagaagaacctgacgctgatggctga

DBGET integrated database retrieval system