KEGG   Streptomyces rapamycinicus: M271_43275
Entry
M271_43275        CDS       T02907                                 

Definition
(GenBank) hypothetical protein
  KO
K18686  cyclooctat-9-en-7-ol synthase [EC:4.2.3.146]
Organism
src  Streptomyces rapamycinicus
Pathway
src00999  Biosynthesis of various secondary metabolites - part 1
src01100  Metabolic pathways
src01110  Biosynthesis of secondary metabolites
Module
src_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:src00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    M271_43275
Enzymes [BR:src01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.146  cyclooctat-9-en-7-ol synthase
     M271_43275
SSDB
Motif
Pfam: Terpene_syn_C_2
Other DBs
NCBI-ProteinID: AGP60028
LinkDB
Position
complement(10693735..10694658)
AA seq 307 aa
MTTGLSTAGAQDISRNSVRPYLEECTRRFQEMFDRHVVTRPTKVELTDAELREVIDDCNA
AVAPLGKSVSDERWISYVGVVLWSQSPRHIKDMEAFKAVCVLNCVTFVWDDMDPALHDFG
LFLPQLRKICEKYYGPEDAEVAYEAARAFVTSDHMFRDSPIKAALCTTSPEQYFRFRVTD
IGVDFWMKMSYPIYRHPEFTEHAKTSLAARMTTRGLTIVNDFYSYDREVSLDQITNCFRL
CDVSDETAFKEFFQARLDDMIEDIECIKAFDQLTQDVFLDLIYGNFVWTTSNKRYKTAVN
DVNSRIQ
NT seq 924 nt   +upstreamnt  +downstreamnt
atgacgacaggactttccacggccggggcccaggacatcagccggaacagcgtccgcccg
tacctggaggagtgcacccgccgcttccaggagatgttcgaccgccatgtcgtcacccgg
cccaccaaggtcgaattgaccgacgccgaactgcgtgaggtcatcgacgactgcaacgcg
gcggtggcgccgctcggaaaatcggtttccgatgagcgctggatctcctatgtgggggtg
gtgctgtggtcccagagcccccgccatatcaaggacatggaggcgttcaaggccgtctgc
gtcctgaactgcgtgacgttcgtgtgggacgacatggatcccgcgctccacgacttcggt
ctcttcctgccccagctgcgcaagatctgcgagaagtactacggccccgaggacgcggag
gtcgcgtacgaggcggcacgcgccttcgtcaccagcgaccatatgttccgcgactcgccc
atcaaggcggcgctgtgcaccacgtccccggaacagtatttccgtttccgggtcaccgac
atcggcgtcgacttctggatgaagatgtcgtatccgatctaccggcatccggagttcacc
gaacacgccaagacgagcctggccgcgcgcatgaccacccgcggactcaccatcgtcaac
gacttctactcctatgaccgcgaggtctccctggaccagatcaccaactgtttccggctc
tgcgatgtgagcgatgagacggcgttcaaggagttcttccaggcccggctcgatgacatg
atcgaggacatcgagtgcatcaaggcgttcgatcagctgacgcaggacgtcttcctcgat
ctgatctacggcaacttcgtctggacgaccagcaacaagcgctacaagacggccgtcaac
gacgtcaactcccgcatccagtga

DBGET integrated database retrieval system