KEGG   Streptomyces rimosus: CP984_02420
Entry
CP984_02420       CDS       T07052                                 
Name
(GenBank) cyclase
  KO
K14249  bifunctional cyclase/aromatase [EC:4.2.1.-]
Organism
srim  Streptomyces rimosus
Pathway
srim00253  Tetracycline biosynthesis
srim01056  Biosynthesis of type II polyketide backbone
srim01100  Metabolic pathways
srim01110  Biosynthesis of secondary metabolites
Module
srim_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:srim00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    CP984_02420
   00253 Tetracycline biosynthesis
    CP984_02420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:srim01008]
    CP984_02420
Enzymes [BR:srim01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     CP984_02420
Polyketide biosynthesis proteins [BR:srim01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C14 cyclized polyketide type
    Nonaketide PKS
     CP984_02420
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc AHSA1 DUF2505
Other DBs
NCBI-ProteinID: QEV74079
LinkDB
Position
643956..644909
AA seq 317 aa
MPAPTSHRAVHRTEIDAPADRVYALIRDAAEWPRHFTPTVHVERAELDARSERLRIWATA
NGEVKHWTSHRALDPEGQSVRFRQEVCSPPVAAMSGEWVLRDLPGGRCELTLHHTFAAVD
DRPEDVEWITTATDRNSRTELANIKALAEAAGSDAELLFSFEDSETVHAPAEAVYAFLAE
AGKWPDRLPHVSRLDLTEPSDGVQVMTMVTRANDGSEHTTESVRVCFPDELRIVYKQIGT
PPLMTLHTGEWSIRDTGDGLLVTSQHTIRINESAIPEILGADATAADARARVRAAVGGNS
AATLALAKRFAEAPHAA
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcccgcacccacatcccaccgcgccgtgcaccgcacggagatcgacgccccggccgac
cgggtgtacgccctgatcagggacgccgccgagtggccccggcacttcaccccgaccgtc
cacgtcgagcgcgcggagctcgacgcccgcagcgagcggctgcggatctgggccaccgcc
aacggcgaggtcaagcactggacgtcgcaccgcgccctggaccccgaagggcagagcgtc
cggttccggcaggaggtgtgttcgcctccggtggccgcgatgagcggtgaatgggtcctc
cgggaccttccgggcgggcggtgcgagctgacgctgcaccacacgttcgccgcggtggac
gaccgcccggaggacgtggagtggatcaccaccgcgaccgaccgcaacagccgtaccgag
ctggcgaacatcaaggcgctggccgaggccgcggggtccgacgcggagctgctgttctcg
ttcgaggactccgagacggtgcacgccccggccgaggcggtgtacgcgttcctcgcggag
gccgggaagtggcccgaccggctgccgcacgtctcccggctcgacctcaccgagccgtcc
gacggcgtgcaggtgatgaccatggtcacccgggccaacgacggctcggagcacacgacg
gagtcggtgcgggtctgcttccccgacgaactgcgcatcgtctacaagcagatcggcacc
ccgccgctgatgaccctgcacaccggtgagtggtcgatacgggacaccggggacgggctg
ctcgtcacctcccagcacaccatccggatcaacgaatccgccatcccggagatcctcggc
gcggacgccacggcggccgacgcgcgggcccgggtgcgcgcggcggtcggcggcaacagc
gcggccaccctggccctcgccaagcgcttcgcggaggccccgcatgccgcctga

DBGET integrated database retrieval system