KEGG   Streptomyces rimosus: CP984_02460
Entry
CP984_02460       CDS       T07052                                 
Name
(GenBank) hypothetical protein
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
srim  Streptomyces rimosus
Pathway
srim00253  Tetracycline biosynthesis
srim01057  Biosynthesis of type II polyketide products
srim01100  Metabolic pathways
srim01110  Biosynthesis of secondary metabolites
Module
srim_M00780  Tetracycline/oxytetracycline biosynthesis, pretetramide => tetracycline/oxytetracycline
Brite
KEGG Orthology (KO) [BR:srim00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP984_02460
   00253 Tetracycline biosynthesis
    CP984_02460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:srim01008]
    CP984_02460
Enzymes [BR:srim01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     CP984_02460
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     CP984_02460
Polyketide biosynthesis proteins [BR:srim01008]
 Polyketide tailoring proteins
  Oxygenase
   CP984_02460
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox HI0933_like FAD_binding_2 NAD_binding_8 Pyr_redox_2 Pyr_redox_3 Thi4
Other DBs
NCBI-ProteinID: QEV74087
LinkDB
Position
652005..653516
AA seq 503 aa
MRYDVVIAGAGPTGLMLACELRLAGARTLVLERLAEPVDFSKALGVHARTVELLDMRGLG
EGFQAEAPKLRGGNFASLGVPLDFSSFDTRHPYALFVPQVRTEELLTGRALELGAELRRG
HAVTALEQDADGVTVSVTGPEGPYEVECAYLVGCDGGGSTVRKLLGIDFPGQDPHMFAVI
ADARFREELPHGEGMGPMRPYGVMRHDLRAWFAAFPLEPDVYRATVAFFDRPYADRRAPV
TEEDVRAALTEVAGSDFGMHDVRWLSRLTDTSRQAERYRDGRVLLAGDACHIHLPAGGQG
LNLGFQDAVNLGWKLGATIAGTAPPELLDTYEAERRPIAAGVLRNTRAQAVLIDPDPRYE
GLRELMIELLHVPETNRYLAGLISALDVRYPMAGEHPLLGRRVPDLPLVTEDGTRQLSTY
FHAARGVLLTLGCDQPLADEAAAWKDRVDLVAAEGVADPGSAVDGLTALLVRPDGYICWT
AAPETGTDGLTDALRTWFGPPAM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgcggtacgacgtggtgatcgccggcgccgggccgaccggcctgatgctcgcctgcgaa
ctgcgcctggccggtgccaggaccctggtgctggaacgcctggcggagccggtcgacttc
tccaaggccctcggtgtgcacgcgcgcaccgtcgagctgctggacatgcgcgggctgggc
gaggggttccaggccgaggcgccgaagctgcgcggcgggaacttcgccagcctcggagta
cccctggacttctcgtcgttcgacacccggcacccgtacgcgctgttcgtcccccaggtg
cgtaccgaggagctgctgaccgggcgggccctggagctgggggccgagctgcggcgcggg
cacgcggtgacggcgctggagcaggacgccgacggcgtgaccgtctccgtcaccgggccc
gaggggccgtacgaggtcgagtgcgcgtacctggtgggctgcgacggcggcggcagcacc
gtacgcaagctgctcggcatcgacttccccgggcaggacccgcacatgttcgcggtgatc
gcggatgcccggttccgtgaggagctgccgcacggggagggcatgggaccgatgcggccg
tacggcgtcatgcggcacgacctgcgcgcctggttcgccgccttcccgctggagccggac
gtctaccgggccacggtcgccttcttcgaccggccctacgccgaccgccgggcgccggtc
accgaggaggacgtgcgggccgcgctgaccgaggtggccggcagcgacttcgggatgcac
gacgtgcgctggctctcccggctcaccgacacctcacgccaggccgagcggtaccgcgac
ggccgggtcctgctggccggcgacgcctgccacatccacctgcccgcgggcggccagggc
ctcaacctgggcttccaggacgcggtgaacctgggctggaagctgggcgcgaccatcgcg
ggcacggctccgccggagctgctggacacctacgaggccgagcgccgcccgatcgccgcc
ggcgtactgcgcaacacccgcgcgcaagccgtgctgatcgacccggacccgcgttacgag
gggctgcgggagctgatgatcgagctgctgcacgtcccggagaccaaccgctatctggcg
ggcctcatctcggcgctggacgtgcggtaccccatggcgggcgagcacccgctgctgggg
cgccgcgtaccggacctgccgctcgtcaccgaggacggcacccggcagctgagcacgtac
ttccacgcggcgcgcggcgtcctgctgacgctcggctgcgaccagccgctcgccgacgag
gccgcggcctggaaggaccgggtggacctggtcgcggccgagggcgtcgcggacccgggc
tccgcggtcgacgggctgaccgcgctgctcgtacgccccgacggctacatctgctggacc
gcggctccggagacgggtacggacgggctcaccgacgccctgcgcacctggttcgggccg
cccgccatgtga

DBGET integrated database retrieval system