KEGG   Streptomyces rectiverticillatus: FGW37_26780
Entry
FGW37_26780       CDS       T06927                                 
Name
(GenBank) phosphoenolpyruvate-utilizing enzyme
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
srk  Streptomyces rectiverticillatus
Pathway
srk00333  Prodigiosin biosynthesis
srk01100  Metabolic pathways
srk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FGW37_26780
SSDB
Motif
Pfam: PPDK_N PEP-utilizers PRA-CH
Other DBs
NCBI-ProteinID: QLE74712
LinkDB
Position
complement(6089632..6092337)
AA seq 901 aa
MATRPQDTATLAARTGDIVVLGGPGQADPAVLGGKAARLADMIAAELPVPPAFCLTTALF
TRYLDGTGLAGKIEGTEGGTVRELILATRIPAPIADEILAAYETLGRPRVAVRSSALKED
SAARSFAGQHDTVLDVAGDAALLDAVRQCWASLWSARATAYRDGATAGAMAVVVQEMIHC
DVSGVLFTVDPVSARPHRVVVEACQGLGEGLVSGRVSSDLFVVDDGSLEVVEERVRYKVA
KWAPLAPGKIGMTKVDAADRDVPCLDHAQLAELAKLGLRVREHYGSEQDVEWGLRDGAFH
LFQTRPITTRPAPGDAASRAGTLSPYVTEQPEPVQQGTLWSRMDIGEIFVGLMTPLGLSF
ARYYQKNVHLDCAAALGVRNTGEADLHMGYYQGHVYLNISYSAYLLGQALPTRNQRHFTK
RFVGEEVEGGALADYENPFGTFPGGTEGLRSTAHWLRFTAAEAVKMKSRSGEMVASRLYE
FDRARRLDLSRMSRRELHAELTRNLGYFHDMHIGYMPYYINAFGFYGILTELCRMWLGEE
GENLQNRIKTDMSSLRTVESAKEIWAVAQAAKDRPRVLRIIGEQPLDRVEETLRADDEGA
VFWERHMEPFLRANGTRGHQEMEITHPRWIDDPSYIFQMIRRYASDGFSADDILKRSSGY
RDDSREILKKLSLPQRKVIESVISLYALCSELRETTRMSMITSIWLVRNVVYEVGRRLVD
KGVLHSLDEVAHLDFEDVRAYLAGEAGEPEAFPRERIDEARRVHEYRKRLPEPPLTFIGE
HDITQAVRPAPDGARLSGLGASPGRVVGRARIVEDLAWQADEFEAGEILVTRYTDASWTP
LFAIAGGVVTDVGSMLSHSSIVSREFHVPSVVNTKYATQRISTGDMVMVDGDTGTVEVVE
G
NT seq 2706 nt   +upstreamnt  +downstreamnt
atggcaacccgtccccaagacaccgccaccctcgcagcacggaccggcgacatcgtcgtc
ctcggcggtcccgggcaggccgaccccgccgtcctcggcggcaaggcggcccggctcgcc
gacatgatcgcggcggagctgccggtgccgcccgccttctgcctgaccaccgctctcttc
acccgctacctcgacggcaccggcctggccggcaagatcgagggcaccgagggcgggacg
gtccgcgagctgatcctcgcgacccgcatcccggccccgatcgccgacgagatcctcgcc
gcctacgagacgctcggccggccgcgggtggccgtgcgctcctcggcgctcaaggaggac
tccgcggcgcgctccttcgccggccagcacgacacggtgctggacgtcgcgggggacgcg
gcgctgctggacgccgtgcggcagtgctgggcgtcgctgtggtccgcccgggccacggcc
taccgcgacggcgccacggccggggcgatggccgtcgtcgtccaggagatgatccactgc
gatgtcagcggtgtgctgttcacggtcgaccccgtcagcgcccggccgcaccgcgtggtg
gtcgaggcctgccaggggctgggcgaggggctggtgtccgggcgggtctccagcgacctg
ttcgtcgtcgacgacggcagcctggaggtcgtcgaggagcgggtgcgctacaaggtggcc
aagtgggcgccgctggcacccgggaagatcgggatgacgaaggtcgacgccgccgaccgc
gacgtcccctgcctggaccacgcgcagctcgccgagctcgcgaagctcgggctgcgggtg
cgcgagcactacggcagcgagcaggacgtcgaatggggcctgcgcgacggcgcgttccac
ctcttccagacccgcccgatcaccacccggcccgccccgggcgacgccgcgtcgcgcgcc
gggacgctcagcccgtacgtgacggagcagccggagcccgtccagcagggcaccttgtgg
tcccgcatggacatcggcgagatcttcgtcggcctgatgacgccgctgggcctgagcttc
gcgcgctactaccagaagaacgtccacctggactgcgccgcggccctcggcgtccgcaac
accggcgaagccgacctgcacatgggctactaccaggggcacgtctacctcaacatctcc
tacagcgcctacctgctcggccaggccctgccgacgcgcaaccagcgccacttcaccaag
cggttcgtcggcgaggaggtcgaaggaggagcactcgccgactacgagaaccccttcggg
acgttcccgggcggcacggagggcctgcgctccaccgcgcactggctgcgcttcaccgcc
gccgaggcggtgaagatgaagtcccgctccggcgagatggtcgcctcgcggctctacgag
ttcgaccgcgcccggcggctggacctctcgcgcatgagccgccgcgagctgcacgccgaa
ctcacccgcaacctgggctacttccacgacatgcacatcggctacatgccgtactacatc
aacgccttcgggttctacgggatcctcaccgagctgtgccggatgtggctcggcgaggag
ggcgagaacctgcagaaccgcatcaagacggacatgtccagcctgcggacggtggagtcc
gcgaaggagatctgggccgtcgcccaggccgccaaggaccggccccgggtgctgcgcatc
atcggcgagcagccgctggatcgcgtcgaggagacgctgcgcgcggacgacgagggcgcc
gtcttctgggagcggcacatggagccgttcctgcgcgccaacggcacccgcggccaccag
gagatggagatcacccacccgcggtggatcgacgacccgtcgtacatcttccagatgatc
cggcgctacgcctccgacggcttctccgccgacgacatcctcaagcgcagcagcggctac
cgcgacgactcgcgggagatcctcaagaagctctcgctgccgcagcgcaaggtgatcgag
agcgtcatctcgctgtacgcgctgtgcagcgagctgcgcgagaccacccggatgtcgatg
atcacctcgatctggctggtgcgcaacgtggtgtacgaggtgggccggcgcctggtggac
aagggcgtcctgcactccctcgacgaggtcgcccacctcgacttcgaggacgtgcgggcc
tatctggccggggaggccggcgagccggaggccttcccccgggagcggatcgacgaggcc
cggcgcgtccacgagtaccgcaagcggctgccggagccgccgctgaccttcatcggcgag
cacgacatcacccaggccgtgcggcccgcccccgacggggcccggctgagcgggctgggg
gcgagccccgggcgggtcgtcggccgcgcccgcatcgtggaggacctcgcctggcaggcc
gacgagttcgaggccggcgagatcctcgtgacccgctacaccgacgcgtcgtggacgccg
ctgttcgccatcgccggtggggtcgtcacggacgtcggctcgatgctgtcgcacagctcg
atcgtctcgcgcgagttccacgtgccgtcggtcgtgaacaccaagtacgcgacgcagcgc
atcagcaccggggacatggtcatggtcgacggtgacacggggacggtcgaggtcgtcgaa
ggctga

DBGET integrated database retrieval system