KEGG   Streptomyces rectiverticillatus: FGW37_26850
Entry
FGW37_26850       CDS       T06927                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
srk  Streptomyces rectiverticillatus
Pathway
srk00333  Prodigiosin biosynthesis
srk01100  Metabolic pathways
srk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FGW37_26850
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: QLE74723
LinkDB
Position
6110979..6112163
AA seq 394 aa
MTPTSSRAPGLGAPFPEALRHATGIAALSPSSHNCQPWALARLESRPARRAAADLLGCPD
DGTHVYLALAVDRRRSLTALPAHLLEMRLSCAAYWRMLSRALAAQGWALVRERAHESGGD
GGGGPGADSRLPGGPWPRDWSLLWTAALRRTGEAAESLTALSDAARARHTNRGPYDERPL
APQLLGDLARHPPTGGPATEIRHLTGRHERDVFAGFLARHGGIDFSHPAAWRETHSYIRW
SPAAVRAYGDGFPVTQLFGPMSARQRLAKRIALSPPVMKFLCRFGYDRSLAAGLAAEIRR
TPAVVLMNFAEEAPGVADAFRGGARIADYWLHAATAGLALHPLSVVMQHDPLRAMLQEQL
GLSGRLFFVSRVGRPRTAFPPAPRSAGAADHRTV
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgacaccgacctcttcgcgcgcccccggcctcggcgcacccttccccgaggccctgcgg
cacgccaccggcatcgccgccctcagcccctcctcgcacaactgccagccctgggcgctc
gcccggctggagagcaggccggcgcgccgggccgcggccgacctgctcggctgcccggac
gacggcacccacgtgtacctcgccctcgccgtcgaccgccggcgcagcctcacggccctg
cccgcccacctgctggagatgcggctgagctgtgccgcctactggcggatgctctcccgg
gcgctggccgcccagggctgggcgctggtgcgggaacgggcgcacgagagcgggggcgac
gggggaggcgggcccggcgccgactcccggctgcccggcggcccgtggccccgggactgg
tcgctgctgtggacggcggcgctgcgccggaccggggaggccgccgagagcctgaccgcc
ctgtcggacgcggcccgcgcccggcacaccaaccgcggcccgtacgacgagcggcccctg
gccccgcagctgctcggcgacctcgcgcgccacccgcccaccgggggacccgcgacggag
atccgccacctgacgggacgtcacgagcgtgatgtcttcgcgggcttcctcgcccgccac
ggaggcatcgatttcagccacccggcggcgtggcgggaaacccactcgtacatccgttgg
agcccggcggcggtgcgcgcctacggcgacggcttccccgtgacccagcttttcgggcca
atgtcggcccggcagcggctcgcgaagcggatcgccctgtccccgccggtgatgaaattc
ctgtgccgcttcggttatgaccggtcgctcgccgcaggcctggccgccgagatccgccgc
actcccgccgtcgtgctgatgaacttcgcggaggaagcccccggggtggccgacgccttc
cggggcggcgcgcgcatcgccgactactggctgcacgcggccaccgcggggctggccctg
caccccctgagcgtcgtcatgcagcacgaccccctgcgggcgatgctccaggagcaactg
ggcctttccgggaggctcttcttcgtcagccgtgtcggccggccccgtacggccttccct
ccggcgccccggagcgccggagcggcggatcaccgcacggtctga

DBGET integrated database retrieval system