KEGG   Streptomyces rubrolavendulae: A4G23_04517
Entry
A4G23_04517       CDS       T04616                                 

Definition
(GenBank) hypothetical protein
  KO
K18686  cyclooctat-9-en-7-ol synthase [EC:4.2.3.146]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00999  Biosynthesis of various secondary metabolites - part 1
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
Module
srn_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    A4G23_04517
Enzymes [BR:srn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.146  cyclooctat-9-en-7-ol synthase
     A4G23_04517
SSDB
Motif
Pfam: Terpene_syn_C_2
Other DBs
NCBI-ProteinID: AOT61629
UniProt: A0A1D8G847
LinkDB
Position
5298994..5299914
AA seq 306 aa
MTADLITTGAGAPPAGTARYWAECTERFAALFARHVPHGAEKVPMTDAELREVIDACNRA
VAPLGRTVSDKRWISYMDVVRWSQSARHIKDMEAFKAVCVLNCVTFVWDDMDASLHDFGL
FLPQVRAVCDRYYTPPDADFAYEGARAFVTSDHMFRDAPLKRVLCGTSPEQYFRFRVTDV
GVDFWMRMSYPIYRHPALTEHSKTGLAARMATRGLAVVNDFYSYDRERALGQITNCFRLC
DMADEADFRRFFQARLDDMAEDLECIGAFDDVTRDVLLDLIHGNFVWTTRDLRYQAPVND
VNSRIR
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaccgcagacctgatcacgaccggcgccggagcgcccccggcgggtacggcccgctac
tgggcggagtgcaccgagcggttcgccgccctgttcgcccgccacgtcccccacggggcc
gagaaggtcccgatgaccgacgccgaactgcgcgaggtcatcgacgcctgcaaccgggcg
gtcgccccgctcggcaggacggtctccgacaagcgctggatctcctacatggacgtcgtc
cgctggtcgcagagcgcccgccacatcaaggacatggaggcgttcaaggcggtctgcgtc
ctcaactgcgtcacgttcgtgtgggacgacatggacgcctcgctccacgacttcggcctg
ttcctgccgcaggtgcgcgccgtgtgcgaccggtactacacgccgccggacgccgacttc
gcgtatgagggcgcccgcgcgttcgtgacgagcgaccacatgttccgcgacgcgcccctc
aagcgggtgctgtgcggcacgtcgccggagcagtacttccgcttccgggtcaccgacgtg
ggagtcgacttctggatgcggatgtcgtacccgatctaccggcaccccgccctcaccgag
cactccaagacgggcctcgcggcccggatggccacccgcgggctggccgtcgtcaacgac
ttctactcctacgacagggagcgcgccctcggtcagatcaccaactgcttccggctgtgc
gacatggcggacgaggccgacttccggcggttcttccaggcgcggctggacgacatggcc
gaggacctggagtgcatcggggcgttcgacgacgtcacccgcgacgtcctgctcgacctg
atccacggcaacttcgtctggaccacgcgcgacctgcggtaccaggcgcccgtcaacgac
gtcaactcccggatccggtga

DBGET integrated database retrieval system