KEGG   Streptomyces rubrolavendulae: A4G23_04518
Entry
A4G23_04518       CDS       T04616                                 
Symbol
ptlI_2
Name
(GenBank) Pentalenene oxygenase
  KO
K22997  cyclooctat-9-en-7-ol 5-monooxygenase [EC:1.14.99.61]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00997  Biosynthesis of various other secondary metabolites
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
Module
srn_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various other secondary metabolites
    A4G23_04518 (ptlI_2)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.61  cyclooctat-9-en-7-ol 5-monooxygenase
     A4G23_04518 (ptlI_2)
SSDB
Motif
Pfam: p450 Collagen
Other DBs
NCBI-ProteinID: AOT61630
UniProt: A0A1D8G839
LinkDB
Position
5299927..5301480
AA seq 517 aa
MHTPPPPAPTGPTGPTGPTGPSGSPAFPGPSGLSGSSGASGLSGSSGPSGSAAPSAPPAP
AGSSVPSVSAGSSAPGGPWRAGTAPGAVPLLGHVPALWRRPLEFLASLPAHGDLVELRLG
PTRAYLAAHPELVRNVLLDTRAFEKGGVFDKARQLLGNSLSVSRGEEHRFQRRLLQPAFH
PTKIAAYTTAVADDTRAVTDTWRAGQTLDVSDVMHALLMRIAARTLFSAGLDDATIEEAR
QCLRTVSHGIYRRTVAPLGILEKLPTPGNRAYDRANARLRRIVAEMIDRRRSGGDADDML
STLLRAEHPETGERLDEGQVLDQVVTFLVAGSETTASTLAFVFHLMGTLPEVEARVHAEV
DGVLAGRAPAYDDLPLLPCTRNVITEALRLHPPSWMAMRVTARDVELGPRTLPARTMVLY
SAYALHHNPELFPDPETFDPDRWTPERAARVPRGALLPFGAGSHKCIGDVLALTETALVV
ATVAARWRLRPAPGTRLRPQPKATLEPGPLPMVLERR
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgcacacgcccccgccccccgcaccgaccgggccgaccgggccgaccgggccgaccggg
ccgtccgggtcccccgcgttccccgggccgtcagggctgtccgggtcgtccggggcgtca
gggctgtccgggtcatccgggccgtcaggatccgcggcaccctcggcgccgcccgcgccc
gccgggtcctccgtaccttcggtatccgccgggtcctccgcgcccggcgggccgtggcgg
gccggtaccgctcccggcgctgtcccgctcctcggccacgtgcccgcgctctggcgccgc
cccctggagtttctggcctcgctgcccgcccacggcgacctggtcgagctgcggctcggc
cccaccagggcctacctggccgcccaccccgaactcgtacggaacgtcctgctcgacacc
cgcgccttcgagaagggcggcgtcttcgacaaggcccgccaactcctcggcaacagcctg
tcggtctcgcgcggcgaggagcaccgcttccagcggcggctgctccagcccgccttccac
ccgacgaagatcgccgcctacaccaccgccgtggccgacgacacccgcgccgtcaccgac
acctggcgagcggggcagaccctcgacgtcagcgacgtcatgcacgcgctgctgatgcgg
atcgcggcccgcaccctcttctccgccgggctcgacgacgcgacgatcgaggaggcccgg
cagtgcctgcgcacggtgtcccacggcatctaccggcgcaccgtcgcccccctcggcatc
ctcgagaagctgcccaccccggggaaccgggcctacgaccgcgccaacgccaggctccgg
cggatcgtcgccgagatgatcgaccggcgccgctccggcggcgacgcggacgacatgctc
tccaccctgctgcgggccgagcaccccgagaccggcgagcgactggacgagggccaggtc
ctcgaccaggtcgtcaccttcctcgtcgcgggcagcgagaccaccgcctccacgctcgcc
ttcgtcttccacctgatgggcacgctgcccgaggtggaggcgcgggtgcacgccgaggtg
gacggggtgctggcgggccgcgcaccggcctacgacgacctgcccctcctgccctgtacg
cgcaacgtcatcaccgaggcgctgcgcctccacccgccgtcctggatggcgatgcgggtc
accgcccgcgacgtcgagctgggcccccggaccctcccggcccggacgatggtcctctac
agcgcctacgccctgcaccacaacccggagctcttccccgaccccgagaccttcgacccc
gaccgctggacgcccgaacgggccgcgcgggtgccccgcggcgcgctgctgccgttcggc
gcggggagccacaagtgcatcggcgacgtgctggcgctcaccgagaccgccctggtcgtc
gcgaccgtcgccgcccgctggcggctgcgccccgcgcccggcacccgactgcgcccgcag
ccgaaggccaccctcgaaccgggccccctgccgatggtcctggaacggcgctga

DBGET integrated database retrieval system