KEGG   Streptomyces roseirectus: IAG44_38935
Entry
IAG44_38935       CDS       T07860                                 
Name
(GenBank) reactive intermediate/imine deaminase
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
sroi  Streptomyces roseirectus
Pathway
sroi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:sroi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IAG44_38935
Enzymes [BR:sroi01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     IAG44_38935
SSDB
Motif
Pfam: Ribonuc_L-PSP
Other DBs
NCBI-ProteinID: QNP74839
UniProt: A0A7H0IPX3
LinkDB
Position
9029148..9030146
AA seq 332 aa
MTAFMHDSLEIAFRKSGDTPTERPGRHVLAAIGYGETPVAPFVADHGGIELELPMVAAGD
GFTEFWTTNKQVKAGRMGEVWYAHDGEHLLCAGRIPPAPRYADQTEHAYLGVLRTIRELG
YPHLNRIWNFIGRINEENAEGMETYRDFCLGRARAFERSGIPDEKLCAATGVGATKDGVS
FYSLSRRENVHTHLENPRQVAAYRYPARYGPKSPSFSRATHVRDAGHLYVSGTASIIGHE
TVHHGLIERQCETALGNIAQVIGDANTARHGLSRGYRLTDLDLIKVYVRHEEHVELVREL
CGAAFSPDAEIAFFTVDICRSDLLVEIEGIVR
NT seq 999 nt   +upstreamnt  +downstreamnt
gtgaccgcattcatgcacgattccttggagatcgctttccgaaagtccggggacacaccg
acagaacgtccgggcagacatgtactcgcggcgatcggatacggcgaaacgccggtcgcg
cccttcgtcgccgatcacggcggcatcgagctggagctgcccatggtcgccgccggcgac
ggcttcaccgagttctggaccacgaacaagcaggtcaaggccggtcggatgggcgaggtg
tggtacgcccacgacggcgagcacctgctgtgcgccggtcgcataccgcccgcgccgcgc
tacgccgaccagacggaacacgcctatctcggcgtcctgcgcacgattcgcgaactcggc
tatccgcacctgaaccgaatatggaacttcatcggccggatcaacgaggaaaacgccgag
ggaatggagacgtaccgagatttctgcctgggtagagcgcgggccttcgagcgttcggga
ataccggacgagaaactgtgcgcggcaacaggagtgggggccacgaaggacggcgtgtca
ttctattcgctgagccgcagggaaaacgtccacacccatctcgaaaatccgcggcaagta
gccgcctaccgttacccggcgcgctacggtccgaaatcccccagcttctcgcgggccacc
catgtgcgcgacgccggccacctgtacgtgtcgggcacggcgagcatcatcgggcacgag
accgtgcaccacggcctgatcgagcggcagtgcgaaaccgcgctgggcaatatcgcccag
gtcatcggcgacgcgaacaccgcacggcacggcctgtcccgcggttaccggctgaccgac
ctggacctgatcaaggtgtacgtacggcacgaggaacacgtggagctcgtgcgcgagctg
tgcggcgccgcgttctctcccgacgccgagatcgcgttcttcaccgtggacatctgccgg
tccgacctgctggtggagatcgagggtattgtccgatga

DBGET integrated database retrieval system