KEGG   Serratia plymuthica AS9: SerAS9_1751
Entry
SerAS9_1751       CDS       T01503                                 
Name
(GenBank) Pyruvate, water dikinase., Phosphoenolpyruvate--protein phosphotransferase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
srr  Serratia plymuthica AS9
Pathway
srr00333  Prodigiosin biosynthesis
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
Module
srr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:srr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SerAS9_1751
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: AEF44881
LinkDB
Position
complement(1903723..1906395)
AA seq 890 aa
MSRSLIVELSGDPMLKHHHLGGKGYSLNHLIKAGLPVPPAFCITVQAYQQFIEATVPGQI
LTKGARGEVRDIILGANVPTSLQQAINDAYQQLGDDASIAVRSSALEEDGQHQSFAGQYD
TYLHVKGAEEVLRKVQSCWASLWAERTAHYSQTHASESEIAVVLQVMVDADAAGVMFTQD
PLTGNADQVVIDSCWGLGEGVVSGQVTTDSFTLDKASANLCDRQIRHKSHYCQRDAQGQV
TLLATPEAKRDIPSLTPEQLRQLVTLARQAQLIYRTELDIEWAVKDNQVWLLQARPVTTQ
AKPAQVIYANPWENDQAIKDRAFFSRMDTGEIVTGLMTPLGLSFCRFYQKHIHGPAIKTM
GLADISDWQIYMGYIQGYVYLNISGSAYMLRQCPPTRDEMKFTTRYATADIDFSHYENPY
GKGVQGWSYVKSGWYWLKQQVHNLRSAANTVEQMIALRQQETRRFLALDLTALSLVELEQ
ELQRVDRFFLDSCAAYMPFFLQSFALYDALAQTCERYLKGRGQGLQNRIKASMNNLRTIE
VTLGIIKMVDKVNRQPALKALFEQHSANELVNILPEDEISRAFWQGDFKDFLFEFGTRGR
QEFELSIPRWNDDPSYLLQVMKMYLQHPVDLQKKLRETERLRHQDSEALFKEMTWVGRFK
LKTLTRLYAVMAERREATRPTFITETWFYRCIMLEVLRRLETQGVVKMSDLPYVDFEQFR
AYMAGKIPAQQAFAQTLLDQNRHQHLLNLHAEEPPLAIIGSYTPKMKTPAADNTAGVFTG
LAASPGKVVGKARVITDLPTQAGELQPNEILVARFTDASWTPLFALAAGIVTDIGSTLSH
SCIVAREFGIPAVVNLKVATQLIASGDTLILDGDSGTVIIQRGEEPDADG
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgagtcgctcactgattgtcgaactctccggtgatccgatgctgaagcatcaccatctg
ggtggtaaagggtattcattaaatcatctaatcaaagccggcctgccggtaccgccggca
ttttgcatcactgtccaggcttaccagcaatttattgaagccacagttcccgggcagata
ttgacgaagggtgccagaggcgaggtacgcgatattattctgggcgctaatgtgcccacc
tctttgcagcaggcaatcaacgacgcttatcagcaattgggcgatgacgcctccattgcc
gttcgttcctcggcattggaggaagacggccaacatcaatcctttgccggacagtacgac
acctatctgcatgttaagggcgccgaggaggtattacgcaaggtgcaatcctgctgggcg
tcattgtgggcagaacggacggcgcactacagccagacgcacgcctcggaaagcgagatt
gccgtggtgttgcaggtgatggtggacgccgatgccgccggggtgatgtttacccaggat
ccactgaccggcaatgccgatcaggtggtgatcgacagctgctggggcctgggagaaggc
gtggtctccggacaggtgaccacggacagcttcactctggacaaagccagtgccaacctt
tgcgatcggcaaatccgccacaaatcgcattactgccagcgggatgctcaggggcaagtg
acgctactggccacccctgaggccaaacgcgatatacccagtttgaccccggagcagctg
cgtcaattggtcaccctggccagacaggcccaacttatttaccgcaccgaactggatatt
gaatgggcggtaaaagataaccaggtctggctgctacaggcacggcctgtcactacccag
gccaagcctgctcaggttatctacgccaatccctgggagaacgatcaggcgatcaaggat
cgggcctttttctcgcggatggacacaggagagattgtcactggattgatgacgccgctg
ggattgtcgttttgtcggttctaccagaaacatattcatggcccggcgattaaaaccatg
ggacttgctgatatcagcgattggcaaatctacatggggtatatacagggctatgtttat
ctgaatatttccggttcggcttatatgctcaggcagtgtccgccgacccgtgatgaaatg
aaattcaccacccgttatgccaccgccgacattgacttcagccattatgagaatccctat
gggaaaggcgtgcaaggctggagctacgtcaaaagtggttggtattggctcaaacagcag
gttcacaatctgcgcagtgccgccaacaccgtcgaacagatgattgctttacgccaacag
gaaacccgccgctttctggcgctggatttaaccgccctgtctctggttgaactggagcaa
gaactgcaacgggttgaccgctttttcctcgacagttgcgccgcttacatgccttttttc
ctgcaatcatttgccctctatgacgccctggcgcaaacctgcgaacgctatctcaaaggc
cggggccagggattgcaaaatcgcatcaaggcgtcgatgaacaacctgcgcaccattgaa
gtgacgctgggtatcatcaaaatggtggacaaggtcaatcgacaacctgcactgaaagcg
ctgtttgaacagcacagcgccaatgaattggtcaacatcttgcccgaagatgagatctcc
cgcgcattctggcagggcgattttaaggatttcctgtttgaatttggcacccgtggtcgc
caggaatttgagttgagtattccgcgctggaatgatgatcccagttatctgttgcaggta
atgaaaatgtatttgcagcacccggtggatctgcaaaagaaactcagagaaacggaaagg
ctgcgtcatcaggacagcgaagcactgttcaaagaaatgacatgggtcggtcgattcaag
ttaaaaaccctgaccaggctatatgccgtgatggccgaacgccgtgaggccacccgcccc
acctttatcaccgaaacctggttctatcgctgcattatgctggaagttctgcgacgcctg
gaaactcagggcgtcgttaaaatgagcgacctcccttatgtcgatttcgagcagttccgc
gcctatatggcgggtaaaatcccggcacaacaggcttttgcgcagacactgctcgatcag
aatcgccaccagcatttattgaacttgcatgctgaagagccgccgttggcgattatcggt
tcctacacgccgaaaatgaaaacccccgcagcggataataccgccggcgtattcaccggc
cttgccgcaagccccggcaaagtggtgggaaaagcgcgagtcattaccgacctgccaacc
caggctggtgagcttcaacccaacgaaatcctggtggcgcgctttaccgacgccagttgg
acaccgttattcgcactggcggccggtattgtcaccgatatcggatccacgctttcacac
agttgcattgtggcacgagagtttggcatccccgccgtagtcaacctgaaagtagccacc
caactgattgccagcggagacactctgatcctcgatggcgatagcggaacggtcattatc
caacgcggagaagaacctgacgctgatggctga

DBGET integrated database retrieval system