KEGG   Sus scrofa (pig): 100522878
Entry
100522878         CDS       T01009                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X1
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00250  Alanine, aspartate and glutamate metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100522878 (RIMKLA)
Enzymes [BR:ssc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     100522878 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     100522878 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Rimk_N Synapsin_C
Other DBs
NCBI-GeneID: 100522878
NCBI-ProteinID: XP_020952583
Ensembl: ENSSSCG00000003968
LinkDB
Position
6:complement(168909477..168949921)
AA seq 392 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGNLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDVCHLV
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGSIIADYTM
TLLPSRPTGHMAVLPGLSGPREQKEPDGCGSAQGIGAESGYAVNSGSTSSESEPELGESR
ASAAGSAGAPAPVLPEPGYNMNTRIAAELKLK
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctcacggaccggcgcatccgcgaggattacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggcaacctaggcctgcagctgaaccag
aaggcgctgaccaccttcccggacgtggtgctcgtgcgggtccccaccccctcggtgcag
tcggacagcgacatcacggtcctgcgacacctggagaagctgggctgccgcttggtcaac
cgcccgcagagcatcttaaactgcatcaacaaattctggaccttccaggagctggcggga
catggggtccccatgcccgacaccttctcctatggtgggcatgaagacttctcaaaaatg
atcgatgaagccgagccgctgggctaccccgtggtggtgaagagcacgcgtggacaccgg
ggaaaagccgttttcctcgcgagagacaagcaccacctctcagacgtctgccacctggtc
cgccacgacgtgccctacctgttccagaagtacgtgaaggagtcccacgggaaggacatc
cgcgtggtggtggtcggcggccaggtgatcggctcgatgctgcgctgctccacggacggc
cggatgcagagcaactgctcgctcggtggcgtgggcgtcatgtgcccgctgacggaacaa
ggcaagcagctggccatccaggtgtccaacatcctgggcatggacttctgcggcatcgac
cttctcatcatggacgacggctccttcgtggtgtgcgaggccaacgccaacgtgggcttc
ctcgccttcgaccaggcgtgcaacttggacgtgggcagcatcatcgcggactacaccatg
accttgctgcccagcaggcccaccgggcacatggccgtcctccccgggctgtccggtccc
agggagcagaaggagcccgacggctgcgggtccgcgcagggcatcggcgccgagagcggc
tacgccgtcaacagcgggtcgacgtccagcgagagcgagcccgaactgggggagagccgg
gcctccgccgccggctcggcaggcgccccggcccccgtgctgccggagcccggctacaac
atgaacaccaggattgctgcagagttgaaactgaagtga

DBGET integrated database retrieval system