KEGG   Sus scrofa (pig): 100737399
Entry
100737399         CDS       T01009                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100737399 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ssc04050]
    100737399 (TNFRSF8)
   04090 CD molecules [BR:ssc04090]
    100737399 (TNFRSF8)
Cytokine receptors [BR:ssc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100737399 (TNFRSF8)
CD molecules [BR:ssc04090]
 Proteins
  100737399 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100737399
NCBI-ProteinID: XP_020951031
LinkDB
Position
6:72103309..72174882
AA seq 501 aa
MFCGTSAVNSCARCLPHSVCPPGKVVKFQGTAQRDTVCELPPPGASPDCSTNPQDCKAPA
RRIASPIPGFLPSGTTPQAKPALASPASSEARTTLLRGTTPFAREDAPKSPPSSSSSVGK
LNPDPRLTLQQPCPQGSADCQKQCGRNFYLDRDGRCKACVSCLRGDLVEKTPCTWNSSSV
CECRPGLFCATSAINSCAHCVPRPICPPRMATKLQGAAERDTTDEPPPPGTHPDCSTNPE
DIRAPASPTPSLISLAGEKSGGGITHAWGDASISTSAPISFSSTGKPTLVPGPVLLWVVL
MLVVAVSSGSFLLCHRRACGKWIRQKIHLCYPAQTFRPKLEPVDSRPGKTLTVTRSISVA
EPGTEELGLMSPPAVKTWPSNGGACLESLRLLEASPASTPPTPTDLPELRGTTEHTNNRI
EHIYIMKADTVIVGSVKAEVPEGQGLAGPAGPEFEEALEVDHAPHYPEQETEPPLGSCRD
IMFSVEEEGKEDSLPTTDPGK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgttttgcgggacgtcagccgtcaactcctgtgcccgctgcttgccccactccgtctgc
ccccccgggaaggttgtcaagttccagggcacagcacagagggacactgtctgtgagctg
cctcccccaggggccagccccgactgcagcaccaacccacaggactgcaaggcccccgcc
aggagaattgccagtcccatccctggcttccttcccagcggcaccaccccccaggccaag
ccggcccttgcatccccagcgagctccgaggccaggaccacgcttctcagaggcaccacc
cccttcgccagggaagatgctcctaaatcacctcccagctcttcctcctccgtggggaag
ctcaatccagatccacggctgactctacagcagccctgccctcaggggtctgctgactgc
cagaagcagtgtggccgcaacttctacctggacagggacggacgctgcaaggcctgtgtg
agctgtttaagaggtgacctcgtggagaaaacaccatgcacgtggaactcctccagcgtc
tgcgagtgtcggcctggcctgttctgtgccacgtcagccatcaactcctgtgcccactgc
gtcccccgccccatctgcccgccaaggatggccaccaaactccagggtgccgccgagagg
gacaccaccgacgagccacctcccccggggacccaccccgactgcagcaccaacccagag
gacatcagggcgcctgccagccctaccccctccctgatctccttggccggcgagaagagt
ggagggggcatcactcacgcctggggggacgcctccatctcaaccagtgctcccatctct
ttctcctccactgggaagcccactctggttccaggacctgtgctcctctgggtggtcttg
atgctggtggtggccgtcagctctggctccttcctcctgtgccaccggagggcctgcggg
aagtggattcggcagaagatccacctgtgctacccagcccagaccttccggcccaagctg
gagcctgtggattccaggcctgggaagactctgaccgtgaccaggagcatatccgtggca
gagccgggcacagaggagctgggcttaatgagccccccggctgtgaagacctggcccagc
aacgggggagcctgcctggagagcctgcggctgctggaggccagcccggccagcaccccc
ccgacccccactgaccttcctgagctccgagggaccacggagcacaccaacaacaggatt
gagcacatttacatcatgaaggccgacaccgtgattgtggggtccgtgaaggccgaggtg
cctgagggccagggcctggcagggccggcggggcccgagttcgaggaggctctggaggtg
gaccatgccccccactacccggagcaggagacggagccgcctctgggcagctgcagggac
atcatgttctcggtggaggaagaaggcaaggaggattccttgcccacgaccgaccctggg
aaatga

DBGET integrated database retrieval system