KEGG   Sus scrofa (pig): 102160946
Entry
102160946         CDS       T01009                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04927  Cortisol synthesis and secretion
ssc04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102160946 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102160946 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ T4SS_pilin bCoV_NS7B
Other DBs
NCBI-GeneID: 102160946
NCBI-ProteinID: XP_020926573
LinkDB
Position
13:195950949..195973501
AA seq 176 aa
MANRTSAPAPYDSYEYYLDYVDLIPVDEKKLKANKHLIVIAFWVSLVAFVVFLFLILLYM
SWSGSPQTRNNTQHHPTCPWNLGLNLSLCFWRHPARHRAPDGRCSLHRAWLRDQAAAEHL
APSSGCSGRAPPSCCPPPPGPPCSPLGPGPQWGPAGHPLTSGTSPASARCRQNLSM
NT seq 531 nt   +upstreamnt  +downstreamnt
atggccaacaggaccagcgcccccgccccgtacgacagctacgagtactacctggattac
gtggacctcattcccgtggacgagaagaagctgaaagccaacaaacatttgattgtcatc
gccttctgggtgagcctggtggctttcgtggtgtttctcttcctcatcctgctctacatg
tcctggtcaggctccccgcagaccaggaacaacacccagcaccacccaacatgcccctgg
aatcttggcctcaacctctccctctgcttctggaggcaccccgcacgccacagggctcct
gacggacgctgcagcctccaccgagcttggttgagggaccaggcagcggcagagcatctg
gccccctccagcggctgcagtgggagagcccctccatcttgctgcccaccgcccccaggc
ccaccctgctctcctctgggacctggccctcaatggggacccgcagggcatccgctgaca
tcaggaacaagcccagcgagcgcccgctgcagacagaacctctcgatgtag

DBGET integrated database retrieval system