KEGG   Sulfurimonas sediminis: FJR45_00990
Entry
FJR45_00990       CDS       T07337                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
ssei  Sulfurimonas sediminis
Pathway
ssei00541  O-Antigen nucleotide sugar biosynthesis
ssei01100  Metabolic pathways
ssei01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:ssei00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    FJR45_00990
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: QOP42606
UniProt: A0A7M1AZ70
LinkDB
Position
185945..186637
AA seq 230 aa
MLQDKTFLAIIPARGGSKRLPRKNVLNLAGKPLISWSIEAAKQSKYIDEIVVSSDDDEIL
GIAHSLNVTVLKRPATLSTDTATTFEVIQHLIKNFEKQYTHLILLQPTSPLRDSEDIDKA
IELLDKKNADAVVSVCEMEHSPLWSNTLPKNKSMTTFLNKEILNKRSQDLETYYRLNGAI
YVISVTKLLEKKSFFLEESIYAYVMDQKKSIDIDTKLDFEIASYLLSRLI
NT seq 693 nt   +upstreamnt  +downstreamnt
atgttacaggataaaacttttttagccattatacccgcaagaggcggttctaagagattg
cctcgtaaaaatgttttaaatttggcaggaaagcctttgatttcatggagtatagaagct
gccaaacaaagcaaatatattgatgaaattgttgtttcaagtgatgatgatgagatatta
ggtattgctcattctctgaacgtgactgttttaaaacgccctgcaacactttcaacggat
acagccacaacttttgaagtaatacaacatctgataaaaaactttgaaaaacaatataca
catctaattttactgcaaccaacaagccctctacgagatagcgaagatattgacaaagca
atagaacttttagataaaaaaaatgctgatgctgttgtaagtgtgtgtgaaatggagcat
tcaccactttggtccaacactctgccaaaaaacaaaagcatgacaacttttttgaacaaa
gaaattttaaataaaagaagtcaggacctagaaacatactatagattaaatggtgcaata
tatgttataagtgtcacaaaacttttagaaaagaaaagtttttttttagaagagagtata
tatgcatatgtgatggatcaaaaaaagtctattgatattgatacaaaattagactttgaa
atagccagttatttgctttctaggctaatataa

DBGET integrated database retrieval system