KEGG   Streptomyces alfalfae: A7J05_09260
Entry
A7J05_09260       CDS       T05110                                 
Name
(GenBank) oxidoreductase
  KO
K17747  1-deoxy-11beta-hydroxypentalenate dehydrogenase [EC:1.1.1.340]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00998  Biosynthesis of various antibiotics
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
Module
ssia_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    A7J05_09260
Enzymes [BR:ssia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.340  1-deoxy-11beta-hydroxypentalenate dehydrogenase
     A7J05_09260
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Methyltransf_25
Other DBs
NCBI-ProteinID: APY85878
UniProt: A0A1P8TE20
LinkDB
Position
complement(2313790..2314617)
AA seq 275 aa
MHSQTQTAVVTGAASGIGLALSARLARAGASVIMADVEGGALRRRAAELTAQGGQVTAVT
ADLTDPDAVERLADTAFDVLGDIDVVCNNAGVLGPVGQPLWEAPLERMREVFEVNHWAHV
LVARAFVPRLLARGRPAHLVHTASMSAFVVGAGSAAYAASKHADLAVARSLRADLADTGI
RVSVLCPGRVDTPMVQGLTAPRGAGGDTSVSAEAVAGVVVDALGSDRFYLFSNSDAPQRL
RDQFDDVWRHVSLSPPSPEEELWPAPKATTGATKH
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgcactcgcagacccagacggccgtcgtgaccggcgcggccagcggcatcggcctcgcc
ctcagcgcgcgcctcgcacgcgccggcgccagcgtgatcatggcggacgtcgagggcggc
gcgctgcgccgccgtgccgccgaactcacggcccagggcggccaggtcaccgcggtgacc
gccgacctgaccgacccggacgccgtcgaacggctcgcggacaccgcgttcgacgtgctc
ggcgacatcgacgtggtgtgcaacaacgcgggcgtcctcggccccgtgggacagcccctg
tgggaggcgccgctggagcggatgcgggaggtcttcgaggtgaaccactgggcgcacgtg
ctggtggcgcgcgccttcgtgccgcggctcctcgcccgcggccggcccgcccacctggtc
cacaccgcctcgatgtccgccttcgtcgtcggtgcgggcagtgccgcctacgccgcgtcc
aaacacgccgacctcgcggtcgcccgcagcctccgcgccgacctggcggacaccggcatc
cgggtgtcggtgctgtgccccggccgggtcgacacccccatggtccagggcctgaccgcg
ccgcgcggcgcgggcggcgacacctcggtgagcgccgaggccgtcgccggcgtcgtggtg
gacgccctcggctccgaccgcttctacctcttcagcaactccgacgcgccgcagcggctg
cgcgatcagttcgatgacgtatggcgtcatgtttccctttcgcccccttcccccgaggag
gagctgtggcccgcaccgaaggcgacgaccggagcgacgaagcactga

DBGET integrated database retrieval system