Solea solea (common sole): 131444399 Help Entry 131444399         CDS       T10853                                  Symbol arf6b Name (RefSeq) ADP-ribosylation factor 6b   KO K07941   ADP-ribosylation factor 6 Organism ssoe  Solea solea (common sole) Pathway ssoe04144   Endocytosis ssoe04517   IgSF CAM signaling ssoe05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssoe00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     131444399 (arf6b)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     131444399 (arf6b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131444399 (arf6b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssoe04131]     131444399 (arf6b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssoe04147]     131444399 (arf6b)    04031 GTP-binding proteins [BR:ssoe04031]     131444399 (arf6b) Membrane trafficking [BR:ssoe04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131444399 (arf6b)   Arf GTPases and associated proteins    Arf GTPases     131444399 (arf6b) Exosome [BR:ssoe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131444399 (arf6b)   Exosomal proteins of colorectal cancer cells    131444399 (arf6b) GTP-binding proteins [BR:ssoe04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     131444399 (arf6b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  131444399 NCBI-ProteinID:  XP_058470661 LinkDB All DBs Position 18:complement(18641130..18643810) Genome browser AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaagtgctctcaaaaatatttgggaacaaggagatgagaatattaatgctggga cttgatgctgcggggaaaacaactatcctttacaaactgaaactgggacagtctgtcacc acaatccccacagtcggcttcaacgtggagactgtcacctataaaaacgtcaagttcaac gtgtgggatgtggggggccaggataagattcgtcctctgtggcgacactattacacgggc acccaagggttaattttcgtggtcgactgcgccgacagggatcgtatcgacgaggcgaga caggagcttcaccgcatcattaatgaccgggaaatgagggatgccatcatcttgatattc gccaataagcaagacctccctgatgccatgaagccgcatgagatccaggagaagctggga ttgacccgcatcagagataggaattggtatgttcagccctcctgtgcgactacaggtgat ggactgtatgagggcctgacatggctaacctcaaactacaaatcttaa

DBGET integrated database retrieval system