Streptomyces solisilvae: I1A49_29390 Help Entry I1A49_29390       CDS       T07406                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ssoi  Streptomyces solisilvae Brite KEGG Orthology (KO) [BR:ssoi00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     I1A49_29390 Enzymes [BR:ssoi01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      I1A49_29390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Thioredoxin Glrx-like GST_N_3 IU_nuc_hydro Motif Other DBs NCBI-ProteinID:  QPI58475 LinkDB All DBs Position complement(7148992..7149234) Genome browser AA seq 80 aa AA seqDB search MSGTVTMYSTTWCGYCRRLKGQMDREGITYTEINIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKAKVGV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtccggcactgtgacgatgtacagcaccacctggtgcggctactgccgccgtctgaag ggccagatggaccgcgagggcatcacctacaccgagatcaacatcgagcaggacccggag tcggccgccttcgtcgagaaggcgaacggcggcaaccagacggtgccgaccgttctcttc cccgatggatcgaccctgaccaacccgtcccttgcgcaggtcaaggccaaggtcggggtc tga

DBGET integrated database retrieval system