KEGG   Streptomyces spectabilis: CP982_34430
Entry
CP982_34430       CDS       T07323                                 
Name
(GenBank) phosphoenolpyruvate-utilizing enzyme
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
sspb  Streptomyces spectabilis
Pathway
sspb00333  Prodigiosin biosynthesis
sspb01100  Metabolic pathways
sspb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sspb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CP982_34430
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QEV63178
UniProt: A0A5P2XFD7
LinkDB
Position
complement(7911262..7914000)
AA seq 912 aa
MTTNATPDQSTAAPAGAAPHADLVAVVGGPHTAAAEALGGKGARLDELTRAGLPVPPAFC
LTTGLFELFLRESGLGAELRAAEARGEPAAVVRESVLAREIPESVARTVVAAYEELGRPR
VAVRSSAVREDSATRSFAGQHDTVLDVAGDAALLDAVKVCWASLWSDRAAAYRSGSDPVG
SIAVVVQEMVNADVSGVLFTVDPIGGRPNRLVVEACCGLGEGLVSGRVSSDFFVVDDRSL
DVVEERVRYKVTKCAPLAPGRIGMTKVDAADRDAPCLTRDQLTALARLALQVREHYGSEQ
DIEWALRDGALHLLQARPITTRARPEAAEGARSPYLPRHWQEQPDAVRHGTLWSRMDIGE
IFVGLMSPLGLSFARYYQDHVHGDCARALGVRDVGDVGLHMGYFQGHVYLNISYTAYLLG
QALPTRDQRHFTRRFVSEEVDLATYANPFGSFPGGMEDLLSTAHWLRETAREMLVMKGRA
RAMVDTRLYEFDRARRLDLTRMSRRELHAELTRYLDYFHDAHVGYMPYYINAFGFYGILT
ELCAKWLGAAGDNLQNRIKTDMSSLRTVASAQEIWAVAQAAKARPRVMEIIEGAPLEEVA
ERLRADAEGQAFWDTQMEPFLRANGTRGRQEMELTHQRWIDDPSYIFQMIRRYAADGFTA
DDIMGRSRARQEGDVREVLGGLPLPRRKTLEGLISMYALCSELRETTRMSMITSIWLVRN
VVYEVGRRLVDEGVLHCLDEVAQLDFEDVRRYVSGELAVHEAFSREAVEERRRVHEYHNR
LPEPPLTFVGEHDSTRAVRPVKDGARLTGLGSSPGRIVGRARIVEDLVWQADEFQAGEIL
VTRHTDASWTPLFAIAGGVVTDIGSMLSHSSIVSREFNVPSVVNTKHATQTINTGDMVMV
DGDTGVVEIVEG
NT seq 2739 nt   +upstreamnt  +downstreamnt
atgaccacgaacgcgacgccggaccagagcaccgccgcccccgcgggagccgccccgcac
gcggatctcgtcgccgtcgtcggcggcccgcacaccgcggccgccgaggcgctcggcggc
aagggcgcccggctcgacgagctgacccgggcgggcctgccggtgccgcccgcgttctgc
ctcaccaccggcctcttcgagctgttcctgcgcgagagcggcctcggcgccgagctgcgc
gcggccgaggcgcggggtgaaccggccgccgtcgtcagggagtcggtgctcgcccgtgag
atcccggagtccgtcgcgcgcaccgtcgtcgccgcgtacgaggagctggggcgcccgcgc
gtcgcggtgcgctcgtcggcggtgcgcgaggactccgcgacgcggtcgttcgcgggccag
cacgacacggtcctcgacgtggcgggcgacgcggcgctgctggacgccgtcaaggtctgc
tgggcctccctgtggtcggaccgcgcggcggcctaccgctcgggttcggacccggtcggt
tcgatcgccgtggtcgtccaggagatggtgaacgcggacgtcagcggcgtgctgttcacc
gtcgacccgatcggcgggcggcccaaccgcctggtggtggaggcctgttgcgggctcggc
gagggcctggtgtcggggcgggtctccagcgacttcttcgtggtggacgaccgcagcctg
gacgtcgtcgaggagcgggtgcgctacaaggtcaccaagtgcgccccgctcgcgccgggc
cgcatcggcatgacgaaggtggacgccgcggaccgggacgcgccgtgtctgacccgcgac
cagctcaccgccctggcccggctcgcccttcaggtgcgcgagcactacggcagcgaacag
gacatcgagtgggcgctgcgcgacggcgccctgcatctgctccaggcccggcccatcacc
acccgggcacggcccgaggcggccgagggcgcccgcagcccctatctgccgcggcactgg
caggagcagccggacgcggtccggcacggcacgctgtggtcgcgcatggacatcggcgag
atcttcgtgggcctgatgtccccgctcggcctgagcttcgcccgctactaccaggaccat
gtgcacggcgactgcgcgcgggccctcggcgtgcgcgacgtcggcgacgtcggcctgcac
atgggctacttccagggccatgtgtatctgaacatctcctacacggcgtatctgctcggc
caggccctgccgacgcgcgaccagcggcacttcacccgccgcttcgtcagcgaggaggtc
gacctcgccacctacgccaaccccttcgggtcgttccccggcggcatggaggacctcctc
tcgaccgcgcactggctgcgcgagacggcgcgcgagatgctggtgatgaagggccgcgcc
cgcgcgatggtcgacacgcgcctgtacgagttcgaccgcgcccggcgcctggacctgacc
cggatgtcacgccgcgagctgcacgccgaactcacccgctacctggactacttccacgac
gcgcacgtcggctacatgccgtactacatcaacgcgttcgggttctacggcatcctcacc
gagctgtgcgcgaagtggctcggcgccgcgggcgacaacctccagaaccgcatcaagacc
gatatgtcgagcctgcgcacggtggcgtcggcgcaggagatctgggccgtggcgcaggcc
gccaaggccaggccgcgcgtcatggagatcatcgagggcgcgcccctggaggaggtcgcg
gagcggctgcgcgcggacgccgaggggcaggcgttctgggacacccagatggagccgttc
ctgcgcgccaacggcacccgggggcggcaggagatggagctgacccaccagcgctggatc
gacgacccctcgtacatcttccagatgatccgccgctacgccgccgacggcttcacggcc
gacgacatcatgggccgcagccgggcgcgccaggagggcgacgtccgggaggtcctcggc
ggccttccgctgccgcggcgcaagacgctggagggcctgatctccatgtacgcgctctgc
agcgagctgcgggagaccacccgcatgtcgatgatcacgtcgatctggctggtcaggaac
gtggtgtacgaggtggggcgccggctcgtcgacgagggcgtgctgcactgtctcgacgag
gtcgcccagctggacttcgaggacgtacgccgttacgtgagcggcgagttggcggtgcac
gaggcgttctcgcgggaggccgtcgaggagcggcggcgtgtgcacgagtaccacaaccgc
cttccggagccgccgctgacgttcgtcggcgagcacgacagcacgcgcgcggtgcggccg
gtgaaggacggggcgcgcctcacggggctcggctcgtcgccgggccggatcgtggggcgg
gcccggatcgtggaggacctggtgtggcaggccgacgagttccaggcgggcgagatcctc
gtgacccggcacaccgacgcgtcgtggacaccgctgttcgccatcgcgggcggcgtggtc
accgacatcgggtcgatgctctcgcacagctccatcgtgtcccgcgagttcaacgtgccc
tcggtggtcaacaccaagcacgccacccagacgatcaacaccggcgacatggtcatggtc
gacggcgacaccggcgtcgtcgagatcgtcgagggctga

DBGET integrated database retrieval system