Salvia splendens (scarlet sage): 121810935 Help Entry 121810935         CDS       T07627                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sspl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     121810935  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sspl04121]     121810935    03400 DNA repair and recombination proteins [BR:sspl03400]     121810935 Ubiquitin system [BR:sspl04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      121810935    Cul5 complex      121810935 DNA repair and recombination proteins [BR:sspl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      121810935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  121810935 NCBI-ProteinID:  XP_042067610 LinkDB All DBs Position 7:complement(4251540..4254395) Genome browser AA seq 96 aa AA seqDB search MKKEDMVMLISAEGFEFVIDKKAAMVSQTIRSMLTGGFFETEHRKANFPEISTIILEKIC QYFHWYLRYASGKKTEFHIEPELTLELMMAANYLDT NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggaagatatggtcatgctgatcagcgccgagggtttcgaatttgtcatcgac aagaaagcggccatggtttctcagacgatccgcagtatgctcacaggtggttttttcgaa acggagcacagaaaggcaaattttccggagataagcacaattatcctggagaagatctgc cagtattttcattggtatcttcgatatgctagtggcaagaaaactgagttccacattgaa cctgagcttacactggaacttatgatggctgctaactacctcgacacctga

DBGET integrated database retrieval system