Streptomyces subrutilus: CP968_04430 Help Entry CP968_04430       CDS       T07087                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ssub  Streptomyces subrutilus Pathway ssub00261   Monobactam biosynthesis ssub01100   Metabolic pathways ssub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssub00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP968_04430  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssub01008]     CP968_04430 Polyketide biosynthesis proteins [BR:ssub01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP968_04430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU77628 UniProt:  A0A5P2UF58 LinkDB All DBs Position complement(1011346..1011570) Genome browser AA seq 74 aa AA seqDB search MSNPFENDNAAYVVVRNDELQHSLWPAANAVPAGWTVVHGPDGRQACLDHVERVWTDMRP ASLVAALAGTTPRD NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgagaacgacaacgccgcctacgtcgtggtccgcaacgacgaactc cagcactccctgtggcccgcagccaacgccgtccccgccggctggaccgtggtgcacggc cccgacggccgccaggcctgcctggaccacgtcgagcgcgtctggaccgacatgcgcccc gcctccctggtggccgccctggccgggacgacgccccgtgactga

DBGET integrated database retrieval system