KEGG   Serratia surfactantfaciens: ATE40_002175
Entry
ATE40_002175      CDS       T06779                                 
Name
(GenBank) prodigiosin biosynthesis protein PigM
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
ssur  Serratia surfactantfaciens
Pathway
ssur00333  Prodigiosin biosynthesis
ssur01100  Metabolic pathways
ssur01110  Biosynthesis of secondary metabolites
Module
ssur_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:ssur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ATE40_002175
SSDB
Motif
Pfam: TM1586_NiRdase Nitroreductase
Other DBs
NCBI-ProteinID: AOE98132
LinkDB
Position
complement(465794..466852)
AA seq 352 aa
MTQDLFAAALQQAVDIARQAPSSHNCQPWSLHYDADARCGRLAIDRRRALQSLPSLEREM
LMSCGIFFEYLSALLYCAGSPLAWRWEHGPTHLLSFAPAAPAAPDRATHRQLAQLIGERH
TARAAYQPTPINEAQRMQLQTLFDGTASSLSIAGDERARRRVAQLTARHAALDFSDRQAW
RETYQYIRFNERQPTDDGFHLHHLFGPVSPAFKRFFQVAFHPRLSRLATGLRLPAYMAQG
LAQRVAEGPQYLALCLNDESAEHLFATGMRLGRLWLTLQHWGWGLHPISVLVQHAEARRE
LAATLALSAPPVFFARFGHLQQWGSAAPRRSWQSILTAPPSGECAPPGNDSP
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacccaagaccttttcgccgcggcgctgcaacaggccgtggacatcgcgcggcaggcg
ccctcttcacacaactgccaaccctggtctctccactatgacgccgacgcccgatgtggc
cgattggctatcgaccgccgtcgcgccttgcagagcctgccttcgctggaacgcgagatg
ctgatgagctgcgggattttcttcgagtacctcagcgcgctgctctactgtgcaggctcg
cctctcgcctggcgttgggagcatggccccacgcatttactgagctttgcccccgccgcg
cctgccgcgcccgatcgagccacccatcgccaattggcgcagctgatcggcgagcggcat
accgcacgggcggcctatcagcctacgccaatcaatgaagcgcaacggatgcagctgcag
accttgttcgacggaacggcgagttcgctcagtatcgcaggtgacgaacgcgctcgccgt
cgggtcgcgcagctcaccgctcgtcacgccgcgctcgatttctcggatcgccaagcctgg
cgcgaaacctatcaatacatccgcttcaacgaacggcagcctaccgacgacggttttcac
ctgcaccacctgtttggcccggtatccccagcattcaagcgcttcttccaagtggcgttt
catcctcgcttaagccggctggcgaccgggctgcgcttgccggcttatatggcgcaaggg
ctggcgcaacgcgtcgcggaaggcccgcaatacctggcgctgtgtctgaacgacgaaagt
gccgagcacctgttcgccaccggcatgcggcttggacgtctgtggctcacgctgcaacac
tggggttggggattgcatccgatcagcgttctggtgcaacacgccgaggcgcgtcgcgag
ctcgcagcaaccctggcgctcagtgctcccccggtattttttgctcgcttcggccacctg
caacaatggggcagcgcagcacccagacgcagctggcaaagcattttgaccgcgccgcca
tccggcgaatgcgcgcccccggggaacgattccccttaa

DBGET integrated database retrieval system