KEGG   Serratia surfactantfaciens: ATE40_002225
Entry
ATE40_002225      CDS       T06779                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
ssur  Serratia surfactantfaciens
Pathway
ssur00333  Prodigiosin biosynthesis
ssur01100  Metabolic pathways
ssur01110  Biosynthesis of secondary metabolites
Module
ssur_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:ssur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ATE40_002225
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: AOE98142
LinkDB
Position
complement(480162..482828)
AA seq 888 aa
MNPTLVVELSGDKTLEPHRLGGKAHSLNHLIQAGLPVPPAFCITAQAYRQFIEFAVPGAL
LDTGAPGNVRDMILSAAIPAPLDLAIRHACKQLGDGASLAVRSSALEEDGLTHSFAGQYD
TYLHVRGDDEVVRKVQSCWASLWAERAAQYSRTSAAQSDIAVVLQIMVDADAAGVMFTQD
PLTGDANHIVIDSCWGLGEGVVSGQVTTDSFILDKASGEIRERQIRHKPHYCQRDPQGQV
TLLQTPEARRDAPSLTPEQLQQLARLARQTRMIYGAELDIEWAVKDDRVWLLQARPITSQ
AKPVQMLYANPWESDPTIKERAFFSRMDTGEIVTGLMTPLGLSFCQFYQKHIHGPAIKTM
GLADIGNWQIYMGYLQGYVYLNISGSAYMLRQCPPTRDEMKFTTRYATTDIDFSGYKNPY
GPGVQGWAYLKSAWHWLKQQKHNLRSAGATVDAMIALRQRETRRFLALDLTTMTHQELER
ELSRIDGYFLDSCAAYMPFFLQSFALYDALALTCERYLKGRGNGLQNRIKASMNNLRTIE
VTLGILSLVETVNRQPALKALFERHSAQELVTVLPTDPESRAFWQSDFSAFLFEFGARGR
QEFELSLPRWNDDPSYLLQVMKMYLQHPVDLHTKLRETERLRHEDSATLLKAMPWFGRMK
LKFITKLYGVMAERREATRPTFVTETWFYRRIMLEVLRRLEAQGLVKQADLPYVDFERFR
AFMAGEQSAQEAFAADLIERNRHQHLLNLHAEEPPMAIVGGYQPRMKAPTAENAAGMLSG
LAASPGKVVAKARVITDLLAQAGELQPNEILVARFTDASWTPLFALAAGIVTDIGSALSH
SCIVAREFGIPAAVNLKNATQLINSGDTLILDGDSGTVIIQRGERADG
NT seq 2667 nt   +upstreamnt  +downstreamnt
atgaatcctaccctggtggttgaactttccggcgataaaacgctggaaccccatcgcctg
ggcggcaaagcccattcgttgaatcatttgattcaggcgggcttgccggtaccgccggcg
ttttgcatcaccgcgcaggcttaccggcagtttatcgagttcgccgtgccgggagcgctg
ctcgacacgggtgcgccgggcaacgtgcgcgatatgattttgagcgccgccatccccgcc
ccgctcgatctggcgatccgtcacgcctgcaaacagttgggcgacggcgcctcgctcgcc
gtgcgctcttcagcgctggaagaagacggcctgacccactctttcgccgggcaatacgac
acttacctgcacgtgcgcggggatgacgaggtggtgcgcaaggtgcaatcctgctgggcg
tcgctctgggcggaacgcgccgcccagtatagccggacatcggcggcgcagagcgatatc
gccgtcgtcttgcaaatcatggtggatgcagacgccgccggcgtcatgtttacccaagat
ccgctgacaggcgatgccaaccacatcgtcatcgacagctgctgggggctgggggaaggc
gtggtctccggacaggtcaccaccgacagcttcattttggataaggcgagcggcgagatc
cgcgagcggcaaattcgtcacaaaccgcactattgccaacgcgatcctcagggacaggtt
acgctgctgcaaacgcccgaagccaggcgagacgcccccagcctaaccccggaacagctg
caacagcttgccaggctggccaggcaaacgcggatgatttacggcgcggaactggatatc
gaatgggcggtgaaagacgatcgcgtgtggctcctgcaggcgcggccgatcacctcgcag
gccaaaccggttcagatgctttacgccaacccgtgggaaagcgatccgacgatcaaggaa
cgggcctttttctcccgaatggacaccggcgagatcgtcaccggcttgatgacgccgctg
gggctgtcgttttgccagttctaccaaaagcatattcatggcccggcgatcaaaaccatg
gggctggcggatatcggcaattggcagatttatatggggtatttgcaaggctacgtctat
ctgaatatctccggatcggcctacatgctccgccaatgcccgcccacccgcgacgaaatg
aagttcacgacccgctacgccaccaccgatatcgatttcagcgggtacaaaaacccctat
ggccccggcgtacagggatgggcttatctcaagagcgcctggcattggctgaaacagcag
aagcataacctgcgcagcgccggcgcgaccgtcgatgccatgatcgccctgcgccagcgc
gagacgcgccgctttctggcgctggatctgaccaccatgacgcatcaggagctggagcgg
gaactcagccgcatcgacggttacttcctcgacagctgcgccgcctatatgcccttcttc
cttcagtcgttcgcgctctacgatgcgctggcgctgacctgcgaacgttacctcaaaggc
cgcggcaacggattgcaaaatcgcatcaaggcgtcgatgaacaacctgcgcaccatcgaa
gtcacgctgggcattctcagcctggtggagacggtcaatcgtcaaccggcgttgaaggcc
ctgttcgagcgacacagcgcacaggaactggtcaccgtcctgcccaccgatcccgaatcg
cgcgccttctggcaaagcgatttcagcgccttcctattcgagttcggcgcccgtggccgt
caggagttcgaattgagtcttccgcgctggaacgacgatcccagctacctgctgcaagtg
atgaaaatgtatctgcaacatccggtggatctgcacacgaaactgcgggaaacagagcgg
ctgcgccatgaagacagcgcgacgctgcttaaagcgatgccctggtttggccggatgaag
ctgaagttcatcaccaaactgtatggcgtgatggccgaacgccgcgaagcgacccggcca
accttcgtcaccgaaacctggttctaccgccgcatcatgttggaagtgctgcggcgcctg
gaggcacaaggcctggtcaaacaggccgatctgccctatgtggacttcgagcgcttccgc
gcgtttatggcgggggaacagtcggcacaggaggcgttcgccgccgatctgatcgagcgc
aatcgccaccagcatctgctgaacctgcatgcggaagaaccgccgatggcgatcgtcggg
gggtatcagcccaggatgaaagcccccacggcggaaaacgccgccggcatgctgtccggc
ctggcggccagccccggcaaagtggtggcgaaagcgcgcgtcatcaccgatctgctggcg
caggccggcgagctgcagcccaacgaaatcctggtagcgcgctttaccgacgccagctgg
accccgctcttcgcgctggcggcgggcatcgtcaccgatatcggctctgcgctgtcccac
agctgcatcgtcgcacgcgaattcggcatccccgcggcggtcaatctcaagaacgccacc
cagttgatcaacagcggcgacaccttgattctcgacggcgacagcgggacggtcattatt
caacgcggagaacgtgccgatggctag

DBGET integrated database retrieval system