Streptococcus thermophilus CNRZ1066: str0029 Help Entry str0029           CDS       T00212                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stc  Streptococcus thermophilus CNRZ1066 Pathway stc01100   Metabolic pathways stc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     str0029 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     str0029 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 CENP-M Motif Other DBs NCBI-ProteinID:  AAV61647 LinkDB All DBs Position 32633..32851 Genome browser AA seq 72 aa AA seqDB search MQLVIQEQLDREDIVLTEATKLNDLGVDSIELMEFIINLEDEFSLEISDNTIDHMDKVSD LLDYLSEQLNNK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgcagctcgttattcaagagcaattggatagagaggacattgttttaaccgaagctacc aaattaaatgacttgggtgtagattcaatagagcttatggagttcattattaatttggag gatgagttttccctagagatttctgataataccattgatcatatggataaggtatcagat ttgttagactatttgtctgagcaattgaataacaaataa

DBGET integrated database retrieval system