KEGG   Streptomyces tirandamycinicus: DDW44_23095
Entry
DDW44_23095       CDS       T06843                                 

Definition
(GenBank) non-ribosomal peptide synthetase
  KO
K12743  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
stir  Streptomyces tirandamycinicus
Pathway
stir00311  Penicillin and cephalosporin biosynthesis
stir01100  Metabolic pathways
stir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stir00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    DDW44_23095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:stir01008]
    DDW44_23095
Enzymes [BR:stir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     DDW44_23095
Polyketide biosynthesis proteins [BR:stir01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   DDW44_23095
SSDB
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Thioesterase AATase
Other DBs
NCBI-ProteinID: AWI31342
UniProt: A0A2S1SY60
LinkDB
Position
complement(5222223..5233511)
AA seq 3762 aa
MMSARYPTTAADWTARIDGVSSERCDLEMLLKDEWRNRIAVRDDDSGVRATRHRELRVGG
RDYAALKESLRRHDGVSVGAYALATLHSVMRAYGHGNQTVAALVDASGSGDPQRADVLPV
VVDHSEQAGITCLDAAGQLDEALRRKDSYLDPGEILGRGLFDALLVLTDREVALGDLPPA
PLALVVRDAEADGCLEWTLAYAGDLFEDRTIDGVLDVVREVFGQFVGRPADRVFDIELVS
AEQREQLRRWNDTDGDFPQGKRLNQLFEDAARRSPDREAVVFRDTSLTYREVDERSNQVA
HWLLEDTGVRPQELIGLYLDKSDLGVVATLGIWKAGAAYVPIDPAYPADRVRFIVGDTGL
SGIVTNRHHAARLREMLGPQHASVRVIEIETVLARQETAGSAVREAPRLSLDSRDLAYVT
YTSGTTGVPKGVPKYHDSVVNSITDLSERYDMRRPGEERVALFASYVFEPHLRQTLIALV
NEQTLVIVPDDVRLDPDGFPAYVREHSVTYLNATGSVLHHFDLSGCTSLRKLLLVGEELT
AAGLRQLRERYSGLVINEYAFTEAAFVTAVKEFAPGVTERRDRSIGRPVRNVTWYVLSQD
LKQLPVGAIGELYIGGCGVAPGYLNRDDLTAERFMPNPFQTDRDRARGLNSRIYRTGDLA
RVLPSGEVEFLGRSDFQLKLNGVRVEPGEIEAQATEYPGVRKCVVVAREGAGGATDRHLV
GYYVTEPSAEVTEDDLLEFLEQRLIRIMVPARMVRLDGIPVNVNGKADWRALPEVDPARP
AGKPVPAGSGGSRPRAAAGGVVDELREIWSTVLGVPAARIGDDDDFFRLGGQSISCILLI
ARLRQRLGALIGVEDVFALRTLGELAHHLDRQRLEGPQPAARPAPGHLPAEGDTTRLLAN
GLQQGLLYHALKRGHGDDAYVMQSVHRYHRPIRAELMREAWQHARRKYPALRLRFEWAEQ
PLQIIDNDDKPFDWRFVDLSGTADPAEQDARIKELQERDRTEPYDPAAGRLFRVYLVKQR
EDLFSLIFSCHHIILDGWSLPVLHDDVHRSYLRLLRGAEVEPAVDGAYTASQRDWEARRN
DHVDHWTREVERIDERGDFGGLVREDIRYQVALSDYDHVREHRTRKLCLGAERTAALKDV
CAAHGVTLHSVLQFVWHKALYAIGGGNTTVVGTIVSGRNPHIEGIENSVGLFINTLPLIV
NHDEQAGMSVGSALSGIQAAVNTMNSKSAVELGRLETAGMKRRLFDTLLVLENYPRLLDE
AEEREHRELLRFEKAYDADKVDYPLAVVAREEGDELTVTLWYAGELFEDATVDALLDTTR
TLFDQVAQDATRRVDALGLVPPAVLERFDAWNRTRTAFPAARTLHAVFEDQAATWPDEIA
VVYRERRLTYRELNERANQLAHYLRSVTTLRPNDLVGLVLDKNELMITAILAVWKTGAAY
VPIDPGYPDDRITFMLQDTQARLVLTNTTHHERLSGLTTPDNTPVLDIDHLPQGYRSTDN
PTTQTGSTDLAYAIYTSGTTGKPKAVLVEHRGVVNLQVSLAKLFGLDKRRGDEALLSFSN
YVFDHFVEQMTDALLNGQKLVVLDDTMRTDAERLYRYIDDEKVTYLSGTPSVLSLYDYST
TKSLTRIDAIGEDFTEPVFNKIRGMFQGTIINGYGPTEISITSHKRLYAPGERRATKSIG
HPVANTTCYVLNKSMQRVPVGGMGELYIGGVGVTRGYLNRDELTADRFLDNPFQTPQERA
AGENARIYRTGDLVRWLPNGELECLGRTDLQVKIRGQRVELGEVEAALSSYPGVTRSLVI
AREHRAAGLAAAQKYLVGFYVSDSEPDEQDVKQWMREKLPEAVVPSRVIRITDIPVTPSG
KLDVQRLPETDFGADDSTEYAAPSNDVEVRLCGIWSTVLGIAPDRVGVHDDFFALGGDSL
RAMVLAQAITTAFGRGLGVATVLRHTTLGAQADHIRDMAAQPDDDRAEPAAGGAAAGAGN
PPVSLAQERLLFIDEFEGGTSAYNIPFALRVGASGDAPTRDAVTAALRTLVRRHPALRTL
LRTDEDGVRRQHTLSPDDATAVFDVAVHTVDGTAELDERLVERSGHVFRLHEELPLRADL
FDLGTARGGLYLSIVLHHSCFDGWSWDVFRRELAALLGGVPETELGAVHGSYADFAVWQR
QYLTGGRLSELTGFWTGALAGFETVRLPLDHPRPARFDYRGREFDFAVDEPTTRALRDLA
RSAGVSLYSVLLGAWCVMLQTYTGQHDLVVGTPSANRGRPEFDRTIGFFANLLALRVRVE
SDATLMDYVRAVGRDVVAAQVHGELPFEQLVKELELEKDPSRHPVLQINFTLQNVTDRTR
QSSAADGQPELTEYRPDGGGWTPTKFDLSATLSETPGGLAGNLTFAASLFDDTSARGFVS
VFQHVLSEFARLSPLAGRTRLAEVSRVDETGRAALLAAGAGDEDASARPAGPARTLHAVF
EEQAATWPDEIAVVYREKRLTYRELNERANQLAHYLRSVTTLRPNDLVGLVLDKNELMIT
AILAVWKTGAAYVPIDPGYPDDRITFMLQDTQARLVLTNTTHHERLSGLTTPDNTPVLDI
DHLPQGYRSTDNPTTQTGSTDLAYAIYTSGTTGKPKAVLVEHRAVDSFRKEVGGRYFGGP
DTSREGVLFLANYVFDFSVEQLALSVLAGHRLIVPPPSPAHDDDFYAYANRTGLTYMSGT
PTQIQQFDLSKLTDLRCLLVAGEAFHERHFDKIRREYSGPIVNAYGTTETAVYNTGRRFE
PGEPYRNGFGEPLGNTRLYVLGDAMQLLPPGAVGELYMAGECVADGYLNRPELTRERFLD
NPFRSEAERRAGRYAVLYRTGDVVRRTVQGEIEYVGRNDEQVKINGLRVELGEVEAVLAA
CPGVRECAVVAAADERRPDVTRLVGYYVADGDPAGGEDAGAGTDEFADEGADEDRIFAAL
RAKLMPGMVPSLLVRLDRPLPMTVNGKLDTKALPRVGLPANRAAYAAPRNRTEARLCQLW
SGPLPGGGTVGIDDDFFRSGGDSISALHLAGQVQREVGRKIGVKDVFDFPTVRRFADHVL
AGPERSRTATGEDGEEPEQGRLTGDCPLLPIQEWFFAKPLADRGWWNHNFAITTPPLDVA
RLRTALGRLVAHHDAFGLRYRGFGGDGDGDGTRITQTYGDDRPDLVLHELDVRGLRDEEV
SRQLAEWQSGFDLEHGPTACAAYLHGAPDGSARVWFALHHLIVDSVSWHILAQDLEILYH
GGELEEKTSSYRQWARALGRYTPGEDERRLWAEITEGMASAAPDGLSAQPGATSHREEFA
LGASDTRSLLTESQWAYDTDMNDLLLTATGLALRSVTGRARNYLTVEGHGRERFDGAPDV
RDTVGWFTTMYPLAVEADQSDLGRSILATKESIRRVPHHGVGYGALFGRYGSERAPLPSV
SFNYLGRLPDEDRWTPDGSAGWRLDSAMSGSNVSDRNGGADQFVLDVTMRCAGGRLLTVV
DSRLDRATTRRFTDELRTWLERLVAHTSSGAAGRTGHTPAVPHAAAEEVFEPYILVDEEN
TEHTLFVFPPGEGGAESYLSNIAQQLPGHRLVLFNNVHLHSAMESFEALAEYYLGHIRNL
RPSGPYSFLGWSFGGVLALEVSLQLARAGQKIDDLFLIDPYFDVRQASAAIGLPGTEDIL
DPINYHYAPDRADLEQLGASVGNLVMFKAGELNEIVRDDQQRRLFEFYRTSPYNGLDRLL
PAESIELHLLRGATHHSWVRNGRLVRGICERISASSSNDRVM
NT seq 11289 nt   +upstreamnt  +downstreamnt
atgatgtcagcacggtatccgacgaccgccgcggactggactgcccgaattgatggagtg
tcaagcgagcgctgcgacctggagatgctcctcaaggacgagtggcgcaacaggatcgcg
gtacgggacgacgactccggtgtccgggcgacccggcaccgggaactgcgcgtcggcggg
cgcgactacgccgcgctgaaggagtccctgcgccgccatgacggcgtgtcggtcggtgcg
tacgcgctggccaccctgcacagcgtgatgcgcgcctacggccatgggaaccagacggtc
gcggcactcgtcgacgcctccggttcgggcgacccgcagcgcgccgacgtcctcccggtc
gtggtggaccacagcgaacaggccgggatcacctgcctcgacgcggccgggcaactcgac
gaggcactgcgccggaaggactcgtacctcgatcccggcgagatcctggggcgcggcctg
ttcgacgccctgctcgtgctcaccgaccgtgaggtggccctgggcgatctgccccccgcg
ccgctcgccctcgtcgtgcgggatgccgaggccgacgggtgccttgagtggacgctggcc
tacgcgggtgacctgttcgaggacaggacgatcgacggcgtcctcgacgtcgtgcgcgag
gtgttcggccagttcgtcggccggcccgcagaccgcgtcttcgacatcgaactggtgtcg
gccgagcagcgggagcagctgcggcggtggaacgacaccgacggcgacttcccgcagggg
aagcggctcaaccagctgttcgaggacgccgcgcggcggtccccggaccgtgaggccgtc
gtgttccgcgacaccagcctgacctatcgggaggtcgacgagcggtccaaccaggtggcg
cactggctgctcgaggacacgggtgtacggccgcaggaactcatcgggctgtacctcgac
aagagcgacctgggcgtcgtcgccactctcggcatctggaaggccggcgcggcctatgtg
ccgatcgaccccgcctacccggccgaccgggtgcgcttcatcgtcggtgacaccggcctc
tccggcatcgtcaccaaccggcaccacgcggcgcggctccgggagatgctcggtccgcag
cacgcctccgtccgcgtcatcgagatcgagaccgtgctggcgcggcaggagaccgcgggg
agtgcggtacgcgaggctccgcggctctccctggacagccgggacctcgcctacgtcacc
tacacctccggcaccaccggagtgccgaagggtgtccccaagtaccacgacagcgtggtg
aacagcatcacggacctgtccgagcggtacgacatgcggcgccccggcgaggagcgcgtc
gcgctcttcgcctcgtacgtcttcgaaccgcacctgaggcagacgctgatcgcgctcgtc
aacgagcagaccctggtgatcgtccccgacgacgtcagactggaccccgacggcttcccc
gcgtacgtccgggagcactcggtcacctatctcaacgccacgggatcggttctccaccac
ttcgacctgagcggctgtaccagcctcagaaagctgctgctggtcggcgaggaactgacg
gcggcggggctgcgccagctccgcgagaggtactccggtctcgtcatcaacgagtacgcc
ttcaccgaggcggccttcgtcaccgccgtcaaggagttcgcaccgggtgtgacggagcgc
agggaccgcagcatcggccggccggtccggaacgtcacgtggtacgtgctgagccaggat
ctgaagcagctgcccgtcggcgccatcggcgagctgtacatcggcggttgcggtgtcgcc
ccgggctatctgaaccgggacgacctgaccgccgagcggttcatgcccaacccgttccag
acggaccgggacagggcacgcgggctgaactcccgcatataccggaccggtgacctcgcg
cgcgtcctgccctccggggaggtggagttcctcgggcgcagcgacttccagctgaagctg
aacggcgtccgcgtcgaacccggcgagatcgaggcacaggcgaccgagtaccccggggtg
cgcaagtgcgtcgtcgtcgcccgtgagggcgccggcggtgccaccgaccgccacctggtc
gggtactacgtgacggagccctcggcggaggtgaccgaggacgacctgctggagttcctg
gagcagcgcctcatccggatcatggtccccgcgcgcatggtccgcctcgacggcatcccg
gtcaacgtcaacggcaaggcggactggcgtgcgctgcccgaggtggacccggcccgcccg
gccgggaagcccgtacccgccggcagcgggggcagccgtccgcgggctgcggccggcggt
gtcgtcgacgagctccgcgagatctggagcacggtgctcggagtgccggcggcacggatc
ggcgacgacgacgacttcttccggctcggtggccagagcatctcctgcatcctgctcatc
gcgcgcctgcggcagcggttgggtgccctcatcggcgtcgaggacgtgttcgccctcagg
accctgggagagctggcgcaccacctggaccggcagcggctcgagggtccgcagccggcg
gcgcggccggcccccgggcacctcccggccgaaggcgacaccacccggctcctcgcgaac
ggcctgcagcaggggctgctctaccacgccctgaagcgcgggcacggcgacgacgcctac
gtcatgcagtcagtgcaccgctaccaccgtcccatccgcgccgagctgatgagggaggcc
tggcagcacgcccggcgcaagtaccccgcgctgaggctgcgtttcgagtgggccgagcag
cccctgcagatcatcgacaacgacgacaagcccttcgactggcgcttcgtcgacctgagc
ggcaccgcggaccccgccgagcaggacgcccgtatcaaggagcttcaggaacgggaccgg
accgagccgtacgatccggccgcgggacggctgttccgggtctacctggtcaagcagcgc
gaggacctgttctcgctgatcttcagctgtcatcacatcatcctggacgggtggagcctg
ccggtcctgcacgacgacgtgcaccgctcctacctccgcctgctccggggtgccgaggtg
gaaccggccgtggacggcgcgtacacggcgtcgcagcgcgactgggaggcgcgccgcaac
gaccacgtcgaccactggacccgcgaggtcgagcgcatcgacgaacgcggtgacttcggt
gggctggtcagggaggacatccggtaccaggtcgcgctgagcgactacgaccacgtacgg
gagcaccgcaccaggaagctgtgcctcggtgccgagcggaccgccgcgctcaaggacgtc
tgcgccgcccacggcgtcacgctgcactcggtgctgcagttcgtgtggcacaaggccctc
tacgccatcggcgggggcaacaccacggtggtggggacgatcgtgtccggacgcaacccc
cacatcgagggcatcgagaactcggtcggcctgttcatcaacacgctgccgctgatcgtc
aaccacgacgagcaggccgggatgagcgtcggctcggccctcagcgggatccaggccgcg
gtgaacacgatgaacagcaagagcgccgtggaactgggccggctggagaccgccgggatg
aagcgccggctcttcgacacgctgctcgtgctggagaactacccgcggctcctggacgag
gccgaggagcgggagcaccgggagctgctccgcttcgagaaggcgtacgacgccgacaag
gtcgactaccccctggccgtcgtggcgcgcgaggagggcgacgagctcacggtcacgctg
tggtacgcgggcgaactcttcgaggacgccaccgtcgacgcgctgctcgacaccacccgg
acactgttcgaccaggtggctcaggacgccacgcgccgcgtcgacgccctcgggctcgtc
ccgccggcggtgctcgaacgcttcgacgcctggaaccgcacccggaccgccttcccggcc
gcccggacgctgcacgcggtcttcgaggaccaggccgcgacctggcccgacgagatcgcg
gtggtgtaccgcgagaggcggctgacctaccgggaactcaacgaacgcgccaaccaactc
gcgcactacctgcgatccgtcaccaccctgcgccccaacgacctcgtcggcctcgtactc
gacaagaacgaactcatgatcaccgccatcctggcggtatggaagaccggcgccgcctac
gtacccatcgacccgggctaccccgacgaccgcatcaccttcatgctccaggacacccag
gcccgcctggtactcaccaacaccacccaccacgaacgactcagcggcctgaccaccccc
gacaacacacccgtactggacatcgaccacctcccccagggctaccggtccaccgacaac
cccaccacccagaccggcagcaccgacctcgcctacgccatctacacctccggcaccacc
ggcaaacccaaagccgtactcgtcgagcaccggggagtcgtcaacctccaggtctccctg
gcgaagctgttcgggctggacaagcgccggggcgacgaggccctcctgtcgttctccaac
tacgtcttcgaccacttcgtggagcagatgaccgacgccctgctcaacgggcagaagctg
gtagtgctcgacgacaccatgcgcaccgacgccgagcgcctgtaccggtacatcgacgac
gagaaggtcacctacctctccggaacgccctcggtcctgtcgctgtacgactactcgacg
acgaagtccctgacccggatcgacgccatcggcgaggacttcaccgagccggtgttcaac
aagatccgcggaatgttccagggcaccatcatcaacgggtacggccccaccgagatatcg
atcacgagccacaagcggctgtacgcgcccggcgagcggcgcgccaccaagagcatcggt
catccggtcgccaacaccacgtgctacgtgctcaacaagtcgatgcagcgggtgccggtc
gggggcatgggcgagctgtacatcggcggcgtcggcgtcacccgcggatacctcaaccgt
gacgagctgacggcggaccgcttcctggacaaccccttccagacgccgcaggagagggcg
gcgggggagaacgcgcgcatctaccggacgggcgacctggtccggtggctccccaacggc
gagctggagtgcctgggccgcaccgacctccaggtcaagatccgcggacagcgggtcgaa
ctcggcgaggtcgaggccgccctgtcgtcctaccccggggtgacccggtccctggtgatc
gcccgcgagcaccgtgccgcggggctcgcggcagcccagaagtacctcgtcggcttctac
gtgagcgacagcgagcccgacgagcaggacgtgaagcagtggatgcgcgagaagctgccc
gaggccgtcgtcccctcccgcgtcatcaggatcacggacatcccggtgacgcccagtggg
aagctggacgtgcagcggcttccggagaccgacttcggcgcggacgacagcaccgagtac
gccgctccctcgaacgacgtcgaggtcaggctctgcggtatctggtccacggtcctcggc
atcgccccggaccgggtgggcgtgcacgacgacttcttcgccctcggcggcgacagcctc
cgtgcgatggtgctcgcccaggccatcaccaccgccttcggccgcggcctgggcgtcgcc
accgtgctgcggcacaccaccctcggcgcacaggcggaccacatccgggacatggccgcg
cagccggacgacgaccgcgccgagccggccgcgggaggcgcggccgcgggcgccgggaac
cccccggtgtcgctcgcgcaggagcggctgctgttcatcgacgagttcgagggcggcacc
tccgcctacaacatcccgttcgcgctccgggtcggcgcgtccggcgacgcgccgacccgg
gatgccgtcaccgcggccctgcggacgctggtgcgccgccatcccgcgctgcgcaccctg
ctcaggaccgacgaggacggcgtccggcggcagcacacgctgtcaccggacgacgcgacg
gccgtgttcgacgtcgccgtgcacaccgtcgacggcaccgccgagctggacgaacggctc
gtcgagcgctccgggcacgtcttccggctgcacgaggaactgcccctccgggcggacctg
ttcgacctcggcacggcccgcggcggcctgtacctgagcatcgtcctccaccacagctgc
ttcgacggctggtcgtgggacgtcttccgccgggagctggccgcgctgctgggtggagtg
cccgagacggagctcggggcggtccacggctcgtacgcggacttcgccgtctggcagcgg
cagtacctcaccggcgggcggctgtccgagctgaccgggttctggaccggcgcactggcc
ggtttcgagacggtcaggctgccgctggaccacccgcggcccgcccggttcgactaccgc
ggccgggagttcgacttcgccgtcgacgagccgaccacccgggcgctgcgggacctggcc
cggtccgcgggagtgagcctgtacagcgtgctgctcggcgcctggtgcgtcatgctccag
acgtacaccggccagcacgacctcgtggtcggaacgccttcggcgaaccgcggacgtccg
gagttcgaccgtacgatcgggttcttcgccaacctgctcgcgctgcgggtccgggtcgag
tcggacgcgacgctgatggactacgtccgcgcggtcggccgggacgtcgtcgcggcgcag
gtgcacggcgagctgccgttcgagcagctcgtcaaggagctcgagctggagaaggacccg
agccgccaccccgtcctccagatcaacttcaccctgcagaacgtcacggaccgcacccgc
cagtcctccgcggcggacgggcagccggagctgaccgagtacaggccggacggcgggggc
tggacgcccaccaagttcgacctgtcggccaccctgtccgagacaccgggcgggctcgcg
ggcaacctgaccttcgccgcgtccctcttcgacgacaccagcgcccgcggattcgtctcg
gtgttccagcacgtcctgtcggagttcgcccggctctcgccgctcgcgggccggacccgg
ctggcggaggtcagccgggtcgacgagacgggccgggcggcgctgcttgccgccggcgcg
ggcgacgaggacgcgtcggcccgccccgccggtcccgcccggacgctgcacgcggtcttc
gaggagcaggccgcgacctggcccgacgagatcgcggtggtgtaccgcgagaagcggctg
acctaccgggaactcaacgaacgcgccaaccagctcgcgcactacctgcgatccgtcacc
accctgcgccccaacgacctcgtcggcctcgtactcgacaagaacgaactcatgatcacc
gccatcctggcggtatggaagaccggcgccgcctacgtacccatcgacccgggctacccc
gacgaccgcatcaccttcatgctccaggacacccaggcccgcctggtactcaccaacacc
acccaccacgaacgactcagcggcctgaccacccccgacaacacacccgtactggacatc
gaccacctcccccagggctaccggtccaccgacaaccccaccacccagaccggcagcacc
gacctcgcctacgccatctacacctccggcaccaccggcaaacccaaagccgtactcgtc
gagcaccgggcggtggacagcttccggaaggaggtcggcgggcgctacttcggcggcccc
gacacctcacgcgagggtgtgctgttcctggcgaactacgtgttcgacttctccgtcgag
cagctggcgctgtcggtcctggcgggtcaccggctcatcgtcccgccgccctcaccggcc
cacgacgacgacttctacgcgtacgcgaaccgtacggggctgacctacatgagcggcaca
cccacgcagatccagcagttcgacctctcgaaactgaccgatctgcggtgcctcctggtc
gccggcgaggccttccacgagcgccacttcgacaagatccggcgcgagtactccggtccg
atcgtcaacgcctacgggaccacggagacggccgtctacaacaccggccgccgcttcgag
cccggtgagccctaccggaacggcttcggcgaaccgctggggaacacccggctgtacgtg
ctcggcgacgcgatgcagctgctcccgccgggagcggtcggcgagctgtacatggccggg
gagtgcgtcgcggacgggtacctgaaccggccggagctcacccgtgagcgcttcctggac
aacccgttccggtccgaggccgagcgccgggccggccggtacgcggtgctctaccggacc
ggtgacgtggtccgacgcaccgtgcagggcgagatcgagtacgtcgggcggaacgacgag
caggtcaagatcaacggcctccgggtcgagctcggcgaggtggaggcggtcctggccgcc
tgtcccggggtgcgcgagtgcgccgtcgtggccgcggccgacgagcgcaggccggacgtc
acgcgcctggtcggctactacgtggcggacggtgacccggccggcggcgaggacgccggc
gcgggcaccgacgagttcgccgacgagggcgccgacgaggacaggatcttcgccgccctc
cgggcgaagctcatgccggggatggtgccgtccctgctggtgcgactcgaccggccgctg
ccgatgaccgtcaacggaaagctcgacaccaaggcgctgccgcgggtcggcctcccggcg
aaccgtgcggcctacgcggccccgcgcaaccgcaccgaggcacggctgtgccagctgtgg
agcgggccgctgccgggcggcggcacggtcggtatcgacgacgacttcttccgctcgggc
ggcgacagcatcagcgcgctgcacctggccggccaggtgcagcgggaggtcgggcgcaag
atcggcgtcaaggacgtcttcgacttcccgacggtgcggcggttcgccgaccacgtcctg
gccgggcccgaacggtcgcgcacggcgaccggcgaggacggcgaggagcccgagcagggc
cggctgaccggggactgcccgctgctgcccatccaggagtggttcttcgcgaagcccctg
gccgaccgcggctggtggaaccacaacttcgccatcacgacaccaccgctcgacgtggcg
aggctgcgcaccgccctgggccggctcgtcgcccaccacgacgcgttcggcctgcgctat
cgcggcttcggcggggatggcgacggggacggcacgcggatcacccagacctacggcgac
gaccgccctgacctcgtgctgcacgagctcgatgtgcggggcctgcgggacgaggaggtc
agcaggcagctcgcggaatggcagagcggattcgacctcgaacacggcccgaccgcctgt
gccgcgtatctgcacggggcccccgacggttccgcgcgcgtctggttcgcgctgcaccat
ctgatcgtcgacagcgtcagctggcacatcctggcgcaggacctcgagatcctctaccac
ggtggtgagctggaggagaagacgagcagctaccggcagtgggcccgggccctggggcgc
tacacccccggtgaggacgagcgcaggctctgggcggagatcaccgaggggatggcctcg
gcggccccggacgggctgtcggcgcagcccggtgcgacgtcgcatcgcgaggagttcgcg
ctcggcgcgtcggacacccggagcctgctcaccgagagccagtgggcgtacgacaccgac
atgaacgacctgctgctgacggcgaccggcctggcgctgcggtcggtcacggggcgggcg
aggaactacctcacggtcgaggggcacggccgcgagcggttcgacggagcacccgatgtc
cgggacaccgtcggatggttcacgacgatgtaccctctcgccgtcgaggcggaccagtcc
gacctcgggcgcagcatcctcgcgaccaaggagtccatccggcgggtgccgcaccacggt
gtcggctacggtgcgctcttcgggcggtacggcagcgagcgggcaccccttccgtcggtg
agcttcaactacctggggcggctcccggacgaggaccggtggacaccggacgggtcggcg
ggctggcggctggactccgcgatgtcgggcagcaacgtctccgaccgcaacgggggagcc
gaccagttcgtcctcgacgtgacgatgagatgcgccggcggtcgcctcctcaccgtggtc
gacagccggctcgaccgggccaccacccggcggttcacggacgaactgaggacgtggctg
gagcggctggtggcccacacctcgtccggggcggcgggaaggacggggcacacgccggcg
gtcccgcacgccgcggccgaggaggtcttcgagccgtacatcctcgtggacgaggagaac
acggagcacaccctgttcgtcttcccgcccggcgagggcggggcggagagctacctgagc
aacatcgcgcagcagcttcccggtcaccggctcgtgctgttcaacaacgtgcatctgcac
tcagccatggagtcgttcgaggctctggccgagtactacctcgggcacatcaggaacctg
cggccgtccggtccttacagcttcctcggctggagtttcggaggggtgctcgctctggag
gtctccctgcagctggcgcgcgcgggccagaagatcgatgatctgttcctcatcgacccg
tacttcgacgtgcggcaggcgtcggcggcgatcgggctccccggcaccgaggacatcctc
gacccgatcaactaccactacgccccggaccgggccgatctggagcaactcggcgcgagc
gtcggcaacctggtgatgttcaaggccggcgagctgaacgagatcgtgcgcgacgaccag
cagcgcaggctgttcgagttctaccggacatcgccgtacaacggcctggaccgcctcctg
cccgccgaatcgatcgagctgcatctgctccgcggcgcaacccaccactcgtgggtacgc
aacgggcgcctggtcaggggcatatgcgagcgcatctcggcctcatcgtcgaacgaccgc
gtgatgtga

DBGET integrated database retrieval system