KEGG   Streptomyces sp. CCM_MD2014: NI25_09760
Entry
NI25_09760        CDS       T04862                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00333  Prodigiosin biosynthesis
strd01100  Metabolic pathways
strd01110  Biosynthesis of secondary metabolites
Module
strd_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NI25_09760
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Abhydrolase_3
Other DBs
NCBI-ProteinID: AIV33742
UniProt: A0A0N6ZGD1
LinkDB
Position
complement(2271765..2272607)
AA seq 280 aa
MSPADLLSQRSAWFPRPVASPAAGQPDPATAPLRLVCFPYAGGTVSAFRGWQEHLGDAVA
VVPVQLPGRGLRLRERPYDTMAPLAEAVADALEEHGLVHDYALFGHSMGALLAYEVACLL
RRRALPAPRHLFVSGSRAPHLYGDRADHTLSDAGLREVIRDLGGLDDADTLGAAYFDRRL
PVLRADLRACERYRWQPRPPLDCPTTAFSATEDPIAAPEAVEAWRPYTTGSFLRRHLPGN
HFFLNGGPSRDRLLAHLGTELDALGTTPHRKATREATWTF
NT seq 843 nt   +upstreamnt  +downstreamnt
atgtcgcccgctgacctgctctcccagcggtccgcctggtttccccgccccgtcgcgtca
ccggccgccgggcagcccgacccggcgaccgcaccgctgcgcctggtctgcttcccctac
gccgggggcacggtctccgcgttccgcggctggcaggagcacctgggcgacgccgtcgcc
gtcgtccccgtgcaactgcccggccgcggactgcggctgcgcgaacgcccgtacgacacc
atggcgcccctcgccgaagcggtcgcggacgccctggaggagcacgggctggtccacgac
tacgccctgttcgggcacagcatgggcgccctgctcgcctacgaggtggcctgcctgctg
cgccggcgcgcactgccggccccccggcacctgttcgtctccggcagccgggcaccgcac
ctgtacggcgaccgcgccgaccacaccctgtccgacgccggactgcgcgaggtgatccgg
gacctgggcggcctcgacgacgcggacaccctcggcgccgcctacttcgaccgcaggctc
ccggtgctccgcgccgacctgcgcgcctgcgagcgctaccgctggcagccccggccgccg
ctggactgcccgacgaccgcgttctccgccaccgaggaccccatcgccgccccggaggcg
gtcgaggcctggcggccctacaccacgggctcgttcctgcgccgccacctgccgggcaac
cacttcttcctgaacggcggcccgtcccgcgaccggctgctcgcccacctgggcaccgaa
ctcgacgccctcggcaccaccccgcacaggaaggcaacaagggaagcaacatggacattc
tga

DBGET integrated database retrieval system