KEGG   Streptomyces sp. CCM_MD2014: NI25_09820
Entry
NI25_09820        CDS       T04862                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00333  Prodigiosin biosynthesis
strd01100  Metabolic pathways
strd01110  Biosynthesis of secondary metabolites
Module
strd_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NI25_09820
SSDB
Motif
Pfam: Nitroreductase FAD_binding_4
Other DBs
NCBI-ProteinID: AIV33754
UniProt: A0A0N6ZGI5
LinkDB
Position
2289669..2290913
AA seq 414 aa
MTTRSSDHAAAPVSTFAQALEAAAGTAALSPSSHNCQPWGLARATTTAARRAAADLTGQD
ADEYLVLALDRERELTALAAHAVEMEVSCGIYWRILLRALAAQGWTAAAVRTLDGDGLTG
SGDETGSGGGSGSASGSRGASGAVGGALLGAGWPAAWTPLCVVALRPGTPSAERLDDLRE
TALARRTHRGPYRPAPVSAELLRDLAKTASPEGGKDAVRLRHLTERRDLRAFAAFVARHA
GLDFAHRAAWRETHSFLRRDLADAAARGDGFTLEQLFGPMSRPRRAAMRRALAPATMHLL
GKVGYHRVLAAGLADIVRRTPAVVTMGFAERAPARAELLRGGARLADYWWRATRHGLSLH
PVSIVIQHEDLRVRLERELSLPGGRTFFVSRIGVAGRPAPHSHRRDDAAGHVAI
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgacgacccgcagctcggaccacgccgccgcgccggtgtccacgttcgcacaggctctt
gaggcggcggcggggacggcggcgctgagtccctcctcgcacaactgccagccgtggggc
ctcgcccgtgccacgaccacggcggcgcggcgggcggcggcggacctgaccggccaggac
gcggacgagtacctggtcctggcactggaccgcgagcgggagctgaccgcgctggccgcc
catgccgtcgagatggaggtgagctgcggcatctactggcggatcctgctgcgcgccctg
gcggcccagggctggacggccgccgcggtgcgcaccctggacggcgacggcttgaccggc
agtggggacgagaccggatccgggggcgggtccggatccgcgagcggctcccggggggcg
tccggggccgtcggtggtgctctgctcggtgccgggtggccggcggcgtggacgccgctg
tgcgtggtggcgctgcgccccgggacgccgtccgcggagcggctggacgacctgcgcgag
accgcgctggcccgccgcacccaccgcgggccgtaccggccggcgccggtctccgcggag
ctgctgcgcgacctggcgaagaccgcctcgccggagggcgggaaggacgcggtccgcctg
cggcacctgaccgagcggcgggacctgcgcgcgttcgccgcgttcgtcgcccggcacgcg
ggcctcgacttcgcgcaccgtgccgcctggcgggagacccactccttcctgcgccgggac
ctcgcggacgccgccgcgcggggagacgggttcacactggagcagctcttcgggccgatg
tcccggccgcgccgggccgcgatgcgccgcgcgctggcgccggccacgatgcacctgctg
gggaaggtcggctaccaccgggtgctggccgccgggctcgccgacatcgtgcgccgcact
ccggccgtggtgaccatgggtttcgcggagcgggcgcccgcccgggcggaactgctgcgc
ggcggagcgcgactggccgactactggtggcgggcgacccggcacgggctgtccctgcac
cccgtcagcatcgtcatccagcacgaggacctgcgcgtccggctggagcgcgagctgtcc
ctgcccggcggccgcacgttcttcgtgagccggatcggtgtcgccggacgtcccgcgccg
cactcccaccggcgcgacgacgccgccgggcacgtggcgatctga

DBGET integrated database retrieval system