KEGG   Streptomyces sp. 769: GZL_08768
Entry
GZL_08768         CDS       T03587                                 

Name
(GenBank) cytochrome P450
  KO
K21146  vitamin D 1,25-hydroxylase [EC:1.14.15.22]
Organism
stre  Streptomyces sp. 769
Pathway
stre00100  Steroid biosynthesis
stre01100  Metabolic pathways
stre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    GZL_08768
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:stre00199]
    GZL_08768
Enzymes [BR:stre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.22  vitamin D 1,25-hydroxylase
     GZL_08768
Cytochrome P450 [BR:stre00199]
 Cytochrome P450, bacteria type
  CYP105 family
   GZL_08768
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AJC61291
UniProt: A0A0A8F4A2
LinkDB
Position
9333098..9334318
AA seq 406 aa
MTDIATTPQATDAPAFPSDRTCPYQLPEGYATLRDTPGPLHRVTLYDGRQVWVVTKHEAA
RKLLADPRLSSKRTDANFPATSPRFEVVREGRPAFIGMDPPEHGPKRRMTISEFTVKRIK
GMRPEVEEIVHGFLDEMLASGPPADLVSQFSLPVPSMVICRLLGVPYADHDFFQDASKRL
VQATDVASASTARQDLVRYMDALITACQAEPRPGLVSTLVTEQLAKGEIDREELASTAML
LLIAGHETTASMTSLSVITLLEHPEQYAALREDRSLIPGAVEELLRYLAIADIAGGRIAL
ADIEIEGQLIRAGEGVIVVNSIANRDGSVYEDPDSFDVRRSARHHLSFGFGVHQCLGQNL
ARLELEVILNALMDRVPTLELAVPVDRLKLRPGTTIQGVNELPVTW
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaccgatatcgccacgacgccccaggccacggatgcgcctgccttccccagtgaccgg
acctgcccctaccagttaccggagggctacgccacgttgcgggacacccccgggcccctg
caccgggtgaccctctacgacggccgccaggtatgggtggtgaccaagcacgaggcggcc
cgcaagctgctcgccgatccgcgcctgtcctccaagcgcaccgatgccaacttccccgcc
acgtccccgcgcttcgaggtggtccgggagggccggccggcgttcatcggcatggacccg
cccgagcacggccccaagcggcggatgacgatcagcgagttcaccgtcaagcggatcaag
ggcatgcgcccggaggtcgaggagatcgtgcacggcttcctcgacgagatgctcgcctcg
ggcccgcccgccgatctggtcagccagttctcgcttccggtgccgtccatggtgatctgc
cgactgctcggcgtgccctacgccgaccatgacttcttccaggacgcgagcaagcgcctg
gtgcaggccacggacgtggcgagcgcctccaccgcgcgccaggacctcgtgcgctacatg
gacgcactcatcaccgcctgtcaggccgagccccggccggggctcgtgagcaccctggtc
accgagcagctcgccaagggcgagatcgaccgtgaggaactggcctccacggcgatgctg
ctgctcatcgccggtcacgagacgaccgcgtcgatgacctccctcagcgtgatcaccctg
ctggaacaccccgagcagtacgccgcgctgcgcgaggaccgcagcctcatccccggtgcg
gtggaggaactgctccgctacctggccatcgcggacatcgccggcgggcgcatcgccctc
gccgacatcgagatcgagggccagctcatccgggccggcgagggcgtcatcgtcgtcaac
tccatagccaaccgcgacggttcggtgtacgaggaccccgactccttcgacgtccgccgc
tccgcgcgccaccatctgtccttcggcttcggtgtgcaccagtgcctgggacagaacctc
gcccgcctggagctggaggtcatcctcaacgcgctgatggaccgcgtcccgacgctcgaa
ctggccgttccggtcgaccggttgaagctgcgaccgggcaccacgatccagggcgtcaac
gagctcccggtcacctggtga

DBGET integrated database retrieval system